add nextflow d30e48d

This commit is contained in:
2026-04-29 23:01:54 +02:00
parent d0b12d668d
commit 97cc9058d3
2840 changed files with 730250 additions and 0 deletions

View File

@@ -0,0 +1,14 @@
# ADDITIONAL TESTS TO VERIFY THE V1 PARSER
complex-names.nf
env-out.nf
env2.nf
error-finish.nf
output-globs.nf
output-dsl.nf
output-val.nf
publish-saveas.nf
singleton.nf
subworkflow.nf
task-retry.nf
tuples.nf
when-block.nf

View File

@@ -0,0 +1,17 @@
#
# run normal mode
#
$NXF_RUN $WITH_DOCKER --out result.txt | tee .stdout
[[ `grep INFO .nextflow.log | grep -c 'Submitted process'` == 5 ]] || false
cmp .expected <(sort .stdout) || false
#
# run resume mode
#
$NXF_RUN $WITH_DOCKER --out result.txt -resume | tee .stdout
[[ `grep INFO .nextflow.log | grep -c 'Cached process'` == 5 ]] || false
cmp .expected <(sort .stdout) || false

View File

@@ -0,0 +1,15 @@
# This protein has 0 bactericidal stretches
# This protein has 0 bactericidal stretches
# This protein has 0 bactericidal stretches
# This protein has 0 bactericidal stretches
# This protein has 0 bactericidal stretches
# This protein has a mean antimicrobial value of 0.235
# This protein has a mean antimicrobial value of 0.25
# This protein has a mean antimicrobial value of 0.251
# This protein has a mean antimicrobial value of 0.266
# This protein has a mean antimicrobial value of 0.28

View File

@@ -0,0 +1,19 @@
set -e
#
# run normal mode
#
$NXF_RUN | tee .stdout
[[ `grep INFO .nextflow.log | grep -c 'Submitted process'` == 2 ]] || false
diff .expected .stdout || false
#
# run resume mode
#
$NXF_RUN -resume | tee .stdout
[[ `grep INFO .nextflow.log | grep -c 'Cached process'` == 2 ]] || false
diff .expected .stdout || false

View File

@@ -0,0 +1,15 @@
Aoba1>
SPVWGQGNKTQAECWEGNHNYGLVRLKEGKTISLTNDGSAVFDYLAVFLN
NVPTIYN
Bscy1>
YGEKDNLRAWWWEIEDEDERHIITMCDGEKMPLEDDNQPEYDWLAYIVGK
PYLGLLNRPV
thp1>
GIEEPRAEQGDSFGLAVLSGKNVTLIDGLHLDIDEEREKKYDYLARYQYG
PSIKKRGIYEVYTGPFDGREGTTENYGNLW
eiv1>
IRELAAVPYIQVSGPHAESEVAYGEPTLNTCYWGVIQGQWAAGSKKRVRD
N
Avhi1>
DRIIKAKRRPVVKIDSNDQIVVAGEGKWLLKAPGKWVPDRSDRYYVRFN

View File

@@ -0,0 +1,19 @@
set -e
#
# run normal mode
#
$NXF_RUN $WITH_DOCKER > stdout
[[ `grep INFO .nextflow.log | grep -c 'Submitted process > blast'` == 5 ]] || false
[[ `grep INFO .nextflow.log | grep -c 'Submitted process > extract'` == 5 ]] || false
[[ `grep INFO .nextflow.log | grep -c 'Submitted process > align'` == 1 ]] || false
#
# run resume mode
#
$NXF_RUN $WITH_DOCKER -resume > stdout
[[ `grep INFO .nextflow.log | grep -c 'Cached process > blast'` == 5 ]] || false
[[ `grep INFO .nextflow.log | grep -c 'Cached process > extract'` == 5 ]] || false
[[ `grep INFO .nextflow.log | grep -c 'Cached process > align'` == 1 ]] || false

View File

@@ -0,0 +1,284 @@
CLUSTAL FORMAT for T-COFFEE Version_11.00.8cbe486 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=338, Nseq=18, Len=694
lcl|1VIE_A VF-------PS----NA---------------------------T-----
lcl|1IHU_A MQFL-----QNIPPY-LFFTGKGGVGKTSISCATAIRLAEQGKRVLLVST
lcl|1ABO_B MND------PN-----L---------------------------------
lcl|1ABO_A MND------PN-----L---------------------------------
lcl|1YCS_B PEITGQVSLPP---GKR---------------------------TNL---
lcl|1IHD_C LPN-------------I---------------------------------
lcl|1IHW_B MIQ-----------------------------------------------
lcl|1IHW_A MIQ-----------------------------------------------
lcl|1IHV_B MIQ-----------------------------------------------
lcl|1IHV_A MIQ-----------------------------------------------
lcl|1YCS_A SS-----SVPS----QK---------------------------T-----
lcl|1PHT_A MS------------------------------------------------
lcl|1YCS_B_1 PEITGQVSLPP---GKR---------------------------TNL---
lcl|1YCS_B_2 PEITGQVSLPP---GKR---------------------------TNL---
lcl|1YCS_B_3 PEITGQVSLPP---GKR---------------------------TNL---
lcl|1ABO_B_1 MND------PN-----L---------------------------------
lcl|1ABO_A_1 MND------PN-----L---------------------------------
lcl|1PHT_A_1 MS------------------------------------------------
lcl|1VIE_A -----------F------------------------GM-GDRVR------
lcl|1IHU_A DPASNVGQVFSQTIGNTIQAIASVPGLSALEIDPQAAAQQYRARIVDPIK
lcl|1ABO_B ----------------------------------------FVA-------
lcl|1ABO_A ----------------------------------------FVA-------
lcl|1YCS_B ------RKTGSER-----------------------IAHGMRVKF-----
lcl|1IHD_C ------------------------------------------------T-
lcl|1IHW_B ---------------------------------------NFRVYY-----
lcl|1IHW_A ---------------------------------------NFRVYY-----
lcl|1IHV_B ---------------------------------------NFRVYY-----
lcl|1IHV_A ---------------------------------------NFRVYY-----
lcl|1YCS_A -----------YQ-----------------------GSYGFRLGF-----
lcl|1PHT_A --------------------------------------------------
lcl|1YCS_B_1 ------RKTGSER-----------------------IAHGMRVKF-----
lcl|1YCS_B_2 ------RKTGSER-----------------------IAHGMRVKF-----
lcl|1YCS_B_3 ------RKTGSER-----------------------IAHGMRVKF-----
lcl|1ABO_B_1 ----------------------------------------FVA-------
lcl|1ABO_A_1 ----------------------------------------FVA-------
lcl|1PHT_A_1 --------------------------------------------------
lcl|1VIE_A --------------------------KKSGA-------------------
lcl|1IHU_A GVLPDDVVSSINEQLSGACTTEIAAFDE-FTGLLTDASLLTRFDHIIFDT
lcl|1ABO_B --------------------------------------------------
lcl|1ABO_A --------------------------------------------------
lcl|1YCS_B --------------------------NPLPLALLLDSSLEGEFDLV----
lcl|1IHD_C -------------------------------ILATGGTIAGGGDSA----
lcl|1IHW_B --------------------------------------------------
lcl|1IHW_A --------------------------------------------------
lcl|1IHV_B --------------------------------------------------
lcl|1IHV_A --------------------------------------------------
lcl|1YCS_A --------------------------LHSGTA------------------
lcl|1PHT_A --------------------------------------------------
lcl|1YCS_B_1 --------------------------NPLPLALLLDSSLEGEFDLV----
lcl|1YCS_B_2 --------------------------NPLPLALLLDSSLEGEFDLV----
lcl|1YCS_B_3 --------------------------NPLPLALLLDSSLEGEFDLV----
lcl|1ABO_B_1 --------------------------------------------------
lcl|1ABO_A_1 --------------------------------------------------
lcl|1PHT_A_1 --------------------------------------------------
lcl|1VIE_A --------------------------------------------------
lcl|1IHU_A APTGHTIRLLQLPGAWSSFIDSNPEGASCLGPMAGLEKQREQYAYAVEAL
lcl|1ABO_B --------------------------------------------------
lcl|1ABO_A --------------------------------------------------
lcl|1YCS_B --------------------------------------------------
lcl|1IHD_C --------------------------------------------------
lcl|1IHW_B --------------------------------------------------
lcl|1IHW_A --------------------------------------------------
lcl|1IHV_B --------------------------------------------------
lcl|1IHV_A --------------------------------------------------
lcl|1YCS_A --------------------------------------------------
lcl|1PHT_A --------------------------------------------------
lcl|1YCS_B_1 --------------------------------------------------
lcl|1YCS_B_2 --------------------------------------------------
lcl|1YCS_B_3 --------------------------------------------------
lcl|1ABO_B_1 --------------------------------------------------
lcl|1ABO_A_1 --------------------------------------------------
lcl|1PHT_A_1 --------------------------------------------------
lcl|1VIE_A --------------------------------------------------
lcl|1IHU_A SDPKRTRLVLVARLQKSTLQEVARTHLELAAIGLKNQYLVINGVLPKTEA
lcl|1ABO_B --------------------------------------------------
lcl|1ABO_A --------------------------------------------------
lcl|1YCS_B --------------------------------------------------
lcl|1IHD_C --------------------------------------------------
lcl|1IHW_B --------------------------------------------------
lcl|1IHW_A --------------------------------------------------
lcl|1IHV_B --------------------------------------------------
lcl|1IHV_A --------------------------------------------------
lcl|1YCS_A --------------------------------------------------
lcl|1PHT_A --------------------------------------------------
lcl|1YCS_B_1 --------------------------------------------------
lcl|1YCS_B_2 --------------------------------------------------
lcl|1YCS_B_3 --------------------------------------------------
lcl|1ABO_B_1 --------------------------------------------------
lcl|1ABO_A_1 --------------------------------------------------
lcl|1PHT_A_1 --------------------------------------------------
lcl|1VIE_A --------------------------------------------------
lcl|1IHU_A ANDTLAAAI----------WEREQEALANLPADLAGLPTDTLFLQPVNMV
lcl|1ABO_B --------------------------------------------------
lcl|1ABO_A --------------------------------------------------
lcl|1YCS_B -----QRIIYEVDDPSLPND-----------------------------E
lcl|1IHD_C -----TKSN----------YTVG-------------------------KV
lcl|1IHW_B --------------------------------------------------
lcl|1IHW_A --------------------------------------------------
lcl|1IHV_B --------------------------------------------------
lcl|1IHV_A --------------------------------------------------
lcl|1YCS_A --------------------------------------------------
lcl|1PHT_A -------------A------------------------------------
lcl|1YCS_B_1 -----QRIIYEVDDPSLPND-----------------------------E
lcl|1YCS_B_2 -----QRIIYEVDDPSLPND-----------------------------E
lcl|1YCS_B_3 -----QRIIYEVDDPSLPND-----------------------------E
lcl|1ABO_B_1 --------------------------------------------------
lcl|1ABO_A_1 --------------------------------------------------
lcl|1PHT_A_1 -------------A------------------------------------
lcl|1VIE_A --------------------------------------------------
lcl|1IHU_A GVSALSRLLSTQPVASPSSDEYLQQRPDIPSLSALVDDIARNEHGLI---
lcl|1ABO_B --------------------------------------------------
lcl|1ABO_A --------------------------------------------------
lcl|1YCS_B GITALHN------------------------------AVCAGHTEIVKFL
lcl|1IHD_C GVE-----------------------------------------------
lcl|1IHW_B --------------------------------------------------
lcl|1IHW_A --------------------------------------------------
lcl|1IHV_B --------------------------------------------------
lcl|1IHV_A --------------------------------------------------
lcl|1YCS_A -----KS------------------------------VTC----------
lcl|1PHT_A --------------------------------------------------
lcl|1YCS_B_1 GITALHN------------------------------AVCAGHTEIVKFL
lcl|1YCS_B_2 GITALHN------------------------------AVCAGHTEIVKFL
lcl|1YCS_B_3 GITALHN------------------------------AVCAGHTEIVKFL
lcl|1ABO_B_1 --------------------------------------------------
lcl|1ABO_A_1 --------------------------------------------------
lcl|1PHT_A_1 --------------------------------------------------
lcl|1VIE_A -------------AWQGQIVGWYCTNLTPE--GYAVES----EAHPGSVQ
lcl|1IHU_A ----------------------------------M---------------
lcl|1ABO_B --------------------------------------------------
lcl|1ABO_A --------------------------------------------------
lcl|1YCS_B VQFGVNVNAADSDGWTPLHCAASCNNVQVC--KFLVES----GAAVFAMT
lcl|1IHD_C ----------------------------------N---------------
lcl|1IHW_B -------R------------------------------------------
lcl|1IHW_A -------R------------------------------------------
lcl|1IHV_B -------R------------------------------------------
lcl|1IHV_A -------R------------------------------------------
lcl|1YCS_A -------------TYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMA
lcl|1PHT_A --------------------------------------------------
lcl|1YCS_B_1 VQFGVNVNAADSDGWTPLHCAASCNNVQVC--KFLVES----GAAVFAMT
lcl|1YCS_B_2 VQFGVNVNAADSDGWTPLHCAASCNNVQVC--KFLVES----GAAVFAMT
lcl|1YCS_B_3 VQFGVNVNAADSDGWTPLHCAASCNNVQVC--KFLVES----GAAVFAMT
lcl|1ABO_B_1 --------------------------------------------------
lcl|1ABO_A_1 --------------------------------------------------
lcl|1PHT_A_1 --------------------------------------------------
lcl|1VIE_A -----I--------------------------------------------
lcl|1IHU_A -------------------------------------------LMGKGGV
lcl|1ABO_B -------------------------------------------LYDFVAS
lcl|1ABO_A -------------------------------------------LYDFVAS
lcl|1YCS_B YSDMQTAADKCEEMEEGYTQCSQFLYGVQEKMGIMNKGV-IYALWDYEPQ
lcl|1IHD_C -------------------------------------------LVNAVPQ
lcl|1IHW_B ------------------------------------------DSRDPVWK
lcl|1IHW_A ------------------------------------------DSRDPVWK
lcl|1IHV_B ------------------------------------------DSRDPVWK
lcl|1IHV_A ------------------------------------------DSRDPVWK
lcl|1YCS_A -----I--------------------------------------------
lcl|1PHT_A ------------------------------------EGYQYRALYDYKKE
lcl|1YCS_B_1 YSDMQTAADKCEEMEEGYTQCSQFLYGVQEKMGIMNKGV-IYALWDYEPQ
lcl|1YCS_B_2 YSDMQTAADKCEEMEEGYTQCSQFLYG-----------------------
lcl|1YCS_B_3 YSDMQTAADKCEEMEEGYTQCSQFLYGVQEKMGIMNKGV-IYALWDYEPQ
lcl|1ABO_B_1 -------------------------------------------LYDFVAS
lcl|1ABO_A_1 -------------------------------------------LYDFVAS
lcl|1PHT_A_1 ------------------------------------EGYQYRALYDYKKE
lcl|1VIE_A --------------------------------------------------
lcl|1IHU_A GKTTMAAAIAVRLADMGFD------VHLTTSDP-------AAHLS-MTLN
lcl|1ABO_B GDNTLS----ITKGEKLRV--------LGYNH-------NGEWCE---AQ
lcl|1ABO_A GDNTLS----ITKGEKLRV--------LGYNH-------NGEWCE---AQ
lcl|1YCS_B NDDELPM----KEGDCMTI--------IHREDED-----EIEWWW---AR
lcl|1IHD_C -LKDIA----NVKGEQVVN--------IGSQDMN-----DNVWLT---LA
lcl|1IHW_B GPAKL-----LWKGEGAVV--------IQDNS-------DIK--------
lcl|1IHW_A GPAKL-----LWKGEGAVV--------IQDNS-------DIK--------
lcl|1IHV_B GPAKL-----LWKGEGAVV--------IQDNS-------DIK--------
lcl|1IHV_A GPAKL-----LWKGEGAVV--------IQDNS-------DIK--------
lcl|1YCS_A --------------------------------------------------
lcl|1PHT_A REEDIDL----HLGDILTVNKGSLVA-LGFSDGQEARPEEIGWLNGY-NE
lcl|1YCS_B_1 NDDELPM----KEGDCMTI--------IHREDED-----EIEWWW---AR
lcl|1YCS_B_2 --------------------------------------------------
lcl|1YCS_B_3 NDDELPM----KEGDCMTI--------IHREDED-----EIEWWW---AR
lcl|1ABO_B_1 GDNTLS----ITKGEKLRV--------LGYNH-------NGEWCE---AQ
lcl|1ABO_A_1 GDNTLS----ITKGEKLRV--------LGYNH-------NGEWCE---AQ
lcl|1PHT_A_1 REEDIDL----HLGDILTVNKGSLVA-LGFSDGQEARPEEIGWLNGY-NE
lcl|1VIE_A --------------------------------------------------
lcl|1IHU_A GSLNNLQVSRIDPHEETERYRQHVLETKGKELDEAGKRLLEEDLRSPCTE
lcl|1ABO_B --TK----------------------------------------------
lcl|1ABO_A --TK----------------------------------------------
lcl|1YCS_B -L-N----------------------------------------------
lcl|1IHD_C KKIN----------------------------------------------
lcl|1IHW_B --------------------------------------------------
lcl|1IHW_A --------------------------------------------------
lcl|1IHV_B --------------------------------------------------
lcl|1IHV_A --------------------------------------------------
lcl|1YCS_A --------------------------------------------------
lcl|1PHT_A -T-T----------------------------------------------
lcl|1YCS_B_1 -L-N----------------------------------------------
lcl|1YCS_B_2 --------------------------------------------------
lcl|1YCS_B_3 -L-N----------------------------------------------
lcl|1ABO_B_1 --TK----------------------------------------------
lcl|1ABO_A_1 --TK----------------------------------------------
lcl|1PHT_A_1 -T-T----------------------------------------------
lcl|1VIE_A --------------------------------------------------
lcl|1IHU_A EIAVFQAFSRVIREAGKRFVVMDTAPTGHTLLLLDATGAYHREIAKKMGE
lcl|1ABO_B --------------------------------------------------
lcl|1ABO_A --------------------------------------------------
lcl|1YCS_B --------------------------------------------------
lcl|1IHD_C -------------TDCDKT-------------------------------
lcl|1IHW_B --------------------------------------------------
lcl|1IHW_A --------------------------------------------------
lcl|1IHV_B --------------------------------------------------
lcl|1IHV_A --------------------------------------------------
lcl|1YCS_A --------------------------------------------------
lcl|1PHT_A --------------------------------------------------
lcl|1YCS_B_1 --------------------------------------------------
lcl|1YCS_B_2 --------------------------------------------------
lcl|1YCS_B_3 --------------------------------------------------
lcl|1ABO_B_1 --------------------------------------------------
lcl|1ABO_A_1 --------------------------------------------------
lcl|1PHT_A_1 --------------------------------------------------
lcl|1VIE_A --------------------------------------------------
lcl|1IHU_A KGHFTTPMMLLQDPERTKVLLVTLPETTPVLEAANLQADLERAGIHPWGW
lcl|1ABO_B ---------------------------------------------NGQGW
lcl|1ABO_A ---------------------------------------------NGQGW
lcl|1YCS_B ---------------------------------------------DKEGY
lcl|1IHD_C --------------------------------------------------
lcl|1IHW_B -------------------------------------------------V
lcl|1IHW_A -------------------------------------------------V
lcl|1IHV_B -------------------------------------------------V
lcl|1IHV_A -------------------------------------------------V
lcl|1YCS_A --------------------------------------------------
lcl|1PHT_A ---------------------------------------------GERGD
lcl|1YCS_B_1 ---------------------------------------------DKEGY
lcl|1YCS_B_2 --------------------------------------------------
lcl|1YCS_B_3 ---------------------------------------------DKEGY
lcl|1ABO_B_1 ---------------------------------------------NGQGW
lcl|1ABO_A_1 ---------------------------------------------NGQGW
lcl|1PHT_A_1 ---------------------------------------------GERGD
lcl|1VIE_A Y-PVAA-LERI---------------------N-----------
lcl|1IHU_A I-INNS-LSIADTRSPLLRMRAQQELPQIESVKR----QHAS--
lcl|1ABO_B V-PSNY-ITPV---------------------NS----------
lcl|1ABO_A V-PSNY-ITPV---------------------NS----------
lcl|1YCS_B V-PRNL-LGLY---------------------PRIKPRQRSL-A
lcl|1IHD_C --------------------------------------------
lcl|1IHW_B V-PRRKA-KII----------------------RD---------
lcl|1IHW_A V-PRRKA-KII----------------------RD---------
lcl|1IHV_B V-PRRKA-KII----------------------RD---------
lcl|1IHV_A V-PRRKA-KII----------------------RD---------
lcl|1YCS_A YKQSQHMTEV----------------------V-----------
lcl|1PHT_A F-PGTY-VEYI---------------------GR----KKISPP
lcl|1YCS_B_1 V-PRNL-LGLY---------------------PRIKPRQRSL-A
lcl|1YCS_B_2 --------------------------------------------
lcl|1YCS_B_3 V-PRNL-LGLY---------------------PRIKPRQRSL-A
lcl|1ABO_B_1 V-PSNY-ITPV---------------------NS----------
lcl|1ABO_A_1 V-PSNY-ITPV---------------------NS----------
lcl|1PHT_A_1 F-PGTY-VEYI---------------------GR---------K

View File

@@ -0,0 +1,20 @@
set -e
#
# run normal mode
#
$NXF_RUN $WITH_DOCKER | tee .stdout
[[ `grep INFO .nextflow.log | grep -c 'Submitted process > blast'` == 5 ]] || false
[[ `grep INFO .nextflow.log | grep -c 'Submitted process > sort'` == 1 ]] || false
diff .expected .stdout || false
#
# run resume mode
#
$NXF_RUN $WITH_DOCKER -resume | tee .stdout
[[ `grep INFO .nextflow.log | grep -c 'Cached process > blast'` == 5 ]] || false
[[ `grep INFO .nextflow.log | grep -c 'Cached process > sort'` == 1 ]] || false
diff .expected .stdout || false

View File

@@ -0,0 +1,34 @@
1aboA 1ABO:A 100.00 57 0 0 1 57 5 61 2e-40 120
1aboA 1ABO:B 100.00 57 0 0 1 57 5 61 2e-40 120
1aboA 1IHD:A 36.11 36 21 1 5 40 287 320 0.62 18.1
1aboA 1IHD:A 75.00 8 2 0 28 35 179 186 0.69 17.7
1aboA 1IHD:C 36.11 36 21 1 5 40 287 320 0.62 18.1
1aboA 1IHD:C 75.00 8 2 0 28 35 179 186 0.69 17.7
1aboA 1YCS:B 25.49 51 36 1 5 53 175 225 3e-04 27.3
1ihvA 1IHN:A 35.00 20 13 0 25 44 72 91 7.0 14.6
1ihvA 1IHN:A 66.67 9 3 0 35 43 28 36 3.7 15.4
1ihvA 1IHN:B 35.00 20 13 0 25 44 72 91 7.0 14.6
1ihvA 1IHN:B 66.67 9 3 0 35 43 28 36 3.7 15.4
1ihvA 1IHU:A 27.27 33 24 0 8 40 534 566 5.5 15.0
1ihvA 1IHV:A 100.00 49 0 0 1 49 4 52 3e-32 99.8
1ihvA 1IHV:B 100.00 49 0 0 1 49 4 52 3e-32 99.8
1ihvA 1IHW:A 100.00 49 0 0 1 49 4 52 3e-32 99.8
1ihvA 1IHW:B 100.00 49 0 0 1 49 4 52 3e-32 99.8
1ihvA 1YCS:A 54.55 11 5 0 1 11 107 117 0.88 17.3
1pht 1IHF:B 33.33 21 14 0 53 73 60 80 0.75 18.1
1pht 1IHS:H 32.00 25 17 0 40 64 175 199 4.0 16.5
1pht 1IHT:H 32.00 25 17 0 40 64 175 199 4.0 16.5
1pht 1PHT:A 100.00 80 0 0 1 80 5 84 1e-56 164
1pht 1YCS:B 23.08 26 20 0 19 44 115 140 3.4 16.5
1pht 1YCS:B 30.43 23 16 0 6 28 175 197 0.015 23.5
1vie 1IHM:A 31.82 22 11 1 19 40 343 360 9.0 14.6
1vie 1IHM:B 31.82 22 11 1 19 40 343 360 9.0 14.6
1vie 1IHM:C 31.82 22 11 1 19 40 343 360 9.0 14.6
1vie 1IHU:A 26.92 26 18 1 25 49 156 181 8.5 14.6
1vie 1VIE:A 100.00 51 0 0 1 51 12 62 1e-35 108
1ycsB 1ABO:A 24.07 54 39 1 3 56 6 57 4e-05 28.5
1ycsB 1ABO:B 24.07 54 39 1 3 56 6 57 4e-05 28.5
1ycsB 1IHU:A 35.71 14 9 0 6 19 251 264 6.9 15.4
1ycsB 1PHT:A 30.43 23 16 0 6 28 10 32 0.013 22.3
1ycsB 1YCS:B 100.00 60 0 0 1 60 170 229 3e-42 131

View File

@@ -0,0 +1,21 @@
set -e
#
# run normal mode
#
$NXF_RUN | tee .stdout
[[ `grep -c 'Submitted process > blastThemAll' .nextflow.log` == 3 ]] || false
[[ `grep -c 'p1.fa p2.fa' .stdout` == 1 ]] || false
[[ `grep -c 'p3.fa p4.fa' .stdout` == 1 ]] || false
[[ `grep -c 'p5.fa' .stdout` == 1 ]] || false
#
# run resume mode
#
$NXF_RUN -resume | tee .stdout
[[ `grep -c 'Cached process > blastThemAll' .nextflow.log` == 3 ]] || false
[[ `grep -c 'p1.fa p2.fa' .stdout` == 1 ]] || false
[[ `grep -c 'p3.fa p4.fa' .stdout` == 1 ]] || false
[[ `grep -c 'p5.fa' .stdout` == 1 ]] || false

View File

@@ -0,0 +1,42 @@
set -e
# Skip test if AWS keys are missing
if [[ ! $AWS_ACCESS_KEY_ID ]]; then
echo "Skip cache-bak test since AWS keys are not available"
exit 0
fi
#
# setup env
#
export NXF_IGNORE_RESUME_HISTORY=true
export NXF_UUID=$(uuidgen | tr [:upper:] [:lower:])
#
# run normal mode
#
$NXF_RUN -name test_1 | tee .stdout
[[ `grep -c 'Submitted process > foo' .nextflow.log` == 1 ]] || false
#
# backup cache
#
NXF_WORK=s3://nextflow-ci/cache-test \
$NXF_CMD -log .nextflow-backup.log plugin nf-tower:cache-backup
#
# remove it
#
rm -rf .nextflow
#
# restore cache
#
NXF_WORK=s3://nextflow-ci/cache-test \
$NXF_CMD -log .nextflow-restore.log plugin nf-tower:cache-restore
#
# run resume mode
#
$NXF_RUN -name test_2 -resume $NXF_UUID | tee .stdout
[[ `grep -c 'Cached process > foo' .nextflow.log` == 1 ]] || false

View File

@@ -0,0 +1,15 @@
set -e
#
# run normal mode
#
$NXF_RUN --chunkSize 3 < .data.fa | tee .stdout
[[ `grep -c 'Submitted process > foo' .nextflow.log` == 2 ]] || false
#
# run resume mode
#
$NXF_RUN -resume --chunkSize 3 < .data.fa | tee .stdout
[[ `grep -c 'Cached process > foo' .nextflow.log` == 2 ]] || false

View File

@@ -0,0 +1,14 @@
>1aboA
NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPS
NYITPVN
>1ycsB
KGVIYALWDYEPQNDDELPMKEGDCMTIIHREDEDEIEWWWARLNDKEGY
VPRNLLGLYP
>1pht
GYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIG
WLNGYNETTGERGDFPGTYVEYIGRKKISP
>1vie
DRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI
N
>1ihvA
NFRVYYRDSRDPVWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRD

View File

@@ -0,0 +1,35 @@
set -e
#
# run normal mode
#
echo ''
$NXF_RUN --alpha uno --beta \* --delta 'x_{1,2}.fasta' --gamma hello\ world --omega '--foo bar' a b c | tee stdout
< stdout grep -F 'alpha: uno'
< stdout grep -F 'beta : *'
< stdout grep -F 'delta: x_{1,2}.fasta'
< stdout grep -F 'gamma: hello world'
< stdout grep -F 'omega: --foo bar'
< stdout grep -F 'args : a_b_c'
#
# check quotes
#
echo ''
$NXF_RUN --alpha "a'b" --beta 'a"b' --delta 'x' --gamma "x" --omega x "a b c" | tee stdout
< stdout grep -F "alpha: a'b"
< stdout grep -F 'beta : a"b'
< stdout grep -F 'delta: x'
< stdout grep -F 'gamma: x'
< stdout grep -F 'omega: x'
< stdout grep -F 'args : a b c'
#
# check the log command handle properly quoted filter options
#
$NXF_CMD -log .nextflow.log log last -F 'container = "ubuntu"' | tee log
[[ $? == 0 ]] || exit 1
$NXF_CMD -log .nextflow.log log last -F "container = 'ubuntu'" | tee log
[[ $? == 0 ]] || exit 1

View File

@@ -0,0 +1,20 @@
# Skip test if AWS keys are missing
if [ -z "$AWS_ACCESS_KEY_ID" ]; then
echo "Missing AWS credentials -- Skipping test"
exit 0
fi
## random file name
NAME=test-cmd-$(basename `mktemp`).file
## create random file
head -c 1000000 </dev/urandom >myfile
## upload it
$NXF_CMD -log cmd-fs-1.log fs cp myfile s3://nextflow-ci/$NAME
## download it
$NXF_CMD -log cmd-fs-2.log fs cp s3://nextflow-ci/$NAME $NAME
## check they are equals
diff myfile $NAME || false

View File

@@ -0,0 +1,8 @@
echo ''
echo \$ $NXF_RUN
$NXF_RUN | tee stdout
[[ `<stdout grep -c 'Entries are saved to file'` == 1 ]] || false
[[ `<stdout grep -c 'alpha'` == 1 ]] || false
[[ `<stdout grep -c 'beta'` == 1 ]] || false
[[ `<stdout grep -c 'gamma'` == 1 ]] || false

View File

@@ -0,0 +1,34 @@
set -e
#
# run normal mode
#
echo ''
echo \$ $NXF_RUN
$NXF_RUN | tee stdout
[[ `grep 'INFO' .nextflow.log | grep -c 'Submitted process > algn'` == 6 ]] || false
[[ `grep 'INFO' .nextflow.log | grep -c 'Submitted process > merge'` == 2 ]] || false
[[ `grep -c 'barcode: alpha' stdout` == 1 ]] || false
[[ `grep -c 'barcode: gamma' stdout` == 1 ]] || false
[[ `grep -c 'bam : bam1 bam2 bam3' stdout` == 2 ]] || false
[[ `grep -c 'bai : bai1 bai2 bai3' stdout` == 2 ]] || false
[[ `grep -c 'seq_ids' stdout` == 2 ]] || false
#
# RESUME mode
#
echo ''
echo \$ $NXF_RUN -resume
$NXF_RUN -resume | tee stdout
[[ `grep 'INFO' .nextflow.log | grep -c 'Cached process > algn'` == 6 ]] || false
[[ `grep 'INFO' .nextflow.log | grep -c 'Cached process > merge'` == 2 ]] || false
[[ `grep -c 'barcode: alpha' stdout` == 1 ]] || false
[[ `grep -c 'barcode: gamma' stdout` == 1 ]] || false
[[ `grep -c 'bam : bam1 bam2 bam3' stdout` == 2 ]] || false
[[ `grep -c 'bai : bai1 bai2 bai3' stdout` == 2 ]] || false
[[ `grep -c 'seq_ids' stdout` == 2 ]] || false

View File

@@ -0,0 +1,44 @@
set -e
#
# basic run
#
echo ''
$NXF_RUN > stdout
[[ `<stdout grep -c 'Hello world!'` == 1 ]] || false
[[ `grep 'INFO' .nextflow.log | grep -c 'Submitted process > foo'` == 1 ]] || false
[[ `grep 'INFO' .nextflow.log | grep -c 'Submitted process > bar'` == 1 ]] || false
( cd foo;
[[ -s f1.fa ]] || false
[[ -s f2.fa ]] || false
[[ -s f3.fa ]] || false
[[ -s hello.txt ]] || false
[[ -s sample.zip ]] || false
[[ -s sample.html ]] || false
[[ -s '01_A(R1).fastq' ]] || false
[[ -s '01_A(R2).fastq' ]] || false
[[ -s 'sample_(1 2).vcf' ]] || false
[[ -s .alpha/hello.txt ]] || false
)
#
# resume
#
rm -rf foo
echo ''
$NXF_RUN -resume > stdout
[[ `<stdout grep -c 'Hello world!'` == 1 ]] || false
[[ `grep 'INFO' .nextflow.log | grep -c 'Cached process > foo'` == 1 ]] || false
[[ `grep 'INFO' .nextflow.log | grep -c 'Cached process > bar'` == 1 ]] || false
( cd foo;
[[ -s f1.fa ]] || false
[[ -s f2.fa ]] || false
[[ -s f3.fa ]] || false
[[ -s hello.txt ]] || false
[[ -s sample.zip ]] || false
[[ -s sample.html ]] || false
[[ -s '01_A(R1).fastq' ]] || false
[[ -s '01_A(R2).fastq' ]] || false
[[ -s 'sample_(1 2).vcf' ]] || false
[[ -s .alpha/hello.txt ]] || false
)

View File

@@ -0,0 +1,39 @@
# apply labels for profile `test1`
$NXF_RUN -c ../../config-labels.config -profile test1 | tee stdout
< stdout grep "alpha memry: 20 MB" || false
< stdout grep "alpha queue: std" || false
< stdout grep "beta memry: 10 MB" || false
< stdout grep "beta queue: small" || false
< stdout grep "delta memry: 70 MB" || false
< stdout grep "delta queue: big" || false
< stdout grep "gamma memry: 70 MB" || false
< stdout grep "gamma queue: big" || false
# apply labels for profile `test2`
$NXF_RUN -c ../../config-labels.config -profile test2 | tee stdout
< stdout grep "beta memry: 10 MB" || false
< stdout grep "beta queue: small" || false
< stdout grep "alpha memry: 70 MB" || false
< stdout grep "alpha queue: big" || false
< stdout grep "delta memry: 70 MB" || false
< stdout grep "delta queue: big" || false
< stdout grep "gamma memry: 70 MB" || false
< stdout grep "gamma queue: big" || false
# apply labels for profile `test3`
$NXF_RUN -c ../../config-labels.config -profile test3 | tee stdout
< stdout grep "beta memry: 50 MB" || false
< stdout grep "beta queue: all" || false
< stdout grep "alpha memry: 50 MB" || false
< stdout grep "alpha queue: all" || false
< stdout grep "delta memry: 50 MB" || false
< stdout grep "delta queue: all" || false
< stdout grep "gamma memry: 60 MB" || false
< stdout grep "gamma queue: foo" || false

View File

@@ -0,0 +1,20 @@
#
# run normal mode
#
$NXF_RUN -c ../../config-vars.config | tee stdout
[[ `grep INFO .nextflow.log | grep -c 'Submitted process'` == 2 ]] || false
< stdout grep "foo 1,2" || false
< stdout grep "bar 3,4" || false
#
# run resume mode
#
$NXF_RUN -c ../../config-vars.config -resume | tee stdout
[[ `grep INFO .nextflow.log | grep -c 'Cached process'` == 2 ]] || false
< stdout grep "foo 1,2" || false
< stdout grep "bar 3,4" || false

View File

@@ -0,0 +1,21 @@
set -e
#
# run normal mode
#
echo ''
$NXF_RUN | tee stdout
[[ `grep 'INFO' .nextflow.log | grep -c 'Submitted process '` == 1 ]] || false
[[ -f outputDir/testFile.txt ]] || false
[[ -L outputDir/testFileLink.txt ]] || false
#
# run resume mode
#
rm -rf outputDir
$NXF_RUN -resume | tee stdout
[[ `grep 'INFO' .nextflow.log | grep -c 'Cached process '` == 1 ]] || false
[[ -f outputDir/testFile.txt ]] || false
[[ -L outputDir/testFileLink.txt ]] || false

View File

@@ -0,0 +1,23 @@
#
# check the ability to load custom script/classes in the
# local `lib` directory
#
set -e
# copy the test script in this directory
cp ${NXF_SCRIPT:-../../custom-lib.nf} test.nf
# crate a library class
mkdir -p lib
cat >lib/Foo.groovy <<EOL
class Foo {
static String hello() { "Hello world!" }
}
EOL
${NXF_CMD:-nextflow} run test.nf | tee stdout
[[ `< stdout grep -c 'Hello world!'` == 1 ]] || false

View File

@@ -0,0 +1,32 @@
set -e
#
# run normal mode
#
echo ''
echo \$ $NXF_RUN
$NXF_RUN | tee stdout
[[ `grep 'INFO' .nextflow.log | grep -c 'Submitted process > sayHello'` == 5 ]] || false
[[ `grep 'Hola world!' stdout` ]] || false
[[ `grep 'Γεια σου world!' stdout` ]] || false
[[ `grep 'Hello world!' stdout` ]] || false
[[ `grep 'Bojour world!' stdout` ]] || false
[[ `grep 'Ciao world!' stdout` ]] || false
#
# RESUME mode
#
echo ''
echo \$ $NXF_RUN -resume
$NXF_RUN -resume | tee stdout
[[ `grep 'INFO' .nextflow.log | grep -c 'Cached process > sayHello'` == 5 ]] || false
[[ `grep 'Hola world!' stdout` ]] || false
[[ `grep 'Γεια σου world!' stdout` ]] || false
[[ `grep 'Hello world!' stdout` ]] || false
[[ `grep 'Bojour world!' stdout` ]] || false
[[ `grep 'Ciao world!' stdout` ]] || false

View File

@@ -0,0 +1,2 @@
1234567890
1234567890

View File

@@ -0,0 +1,18 @@
set -e
#
# run normal mode
#
$NXF_RUN -process.debug | tee stdout
[[ `< .nextflow.log grep -c 'Submitted process'` == 2 ]] || false
[[ `< stdout grep 'task=.small.txt mem=100 MB'` ]] || false
[[ `< stdout grep 'task=.big.txt mem=200 MB'` ]] || false
#
# run resume mode
#
$NXF_RUN -process.debug -resume | tee stdout
[[ `< .nextflow.log grep -c 'Cached process'` == 2 ]] || false

View File

@@ -0,0 +1 @@
12345

View File

@@ -0,0 +1,45 @@
set -e
#
# run normal mode
#
echo ''
$NXF_RUN | tee stdout
[[ `grep 'INFO' .nextflow.log | grep -c 'Submitted process > foo'` == 4 ]] || false
grep '~ Saving my_delta.txt' stdout
grep '~ Saving my_omega.txt' stdout
grep '~ Saving my_gamma.txt' stdout
grep '~ Saving my_alpha.txt' stdout
test -f my_alpha.txt
test -f my_delta.txt
test -f my_gamma.txt
test -f my_omega.txt
diff my_alpha.txt .expected
diff my_delta.txt .expected
diff my_gamma.txt .expected
diff my_omega.txt .expected
rm my_*
#
# RESUME mode
#
echo ''
$NXF_RUN -resume | tee stdout
[[ `grep 'INFO' .nextflow.log | grep -c 'Cached process > foo'` == 4 ]] || false
grep '~ Saving my_delta.txt' stdout
grep '~ Saving my_omega.txt' stdout
grep '~ Saving my_gamma.txt' stdout
grep '~ Saving my_alpha.txt' stdout
test -f my_alpha.txt
test -f my_delta.txt
test -f my_gamma.txt
test -f my_omega.txt

View File

@@ -0,0 +1,2 @@
Hello
World

View File

@@ -0,0 +1,76 @@
set -e
#
# run normal mode
#
echo ''
$NXF_RUN | tee stdout
[[ `grep 'INFO' .nextflow.log | grep -c 'Submitted process > foo'` == 4 ]] || false
grep "Result $PWD/cache/omega/result.txt" stdout
grep "Result $PWD/cache/delta/result.txt" stdout
grep "Result $PWD/cache/alpha/result.txt" stdout
grep "Result $PWD/cache/gamma/result.txt" stdout
test -f my_alpha.txt
test -f my_delta.txt
test -f my_gamma.txt
test -f my_omega.txt
diff my_alpha.txt .expected
diff my_delta.txt .expected
diff my_gamma.txt .expected
diff my_omega.txt .expected
rm my_*
#
# run normal mode -- this time store result are used
#
echo ''
$NXF_RUN | tee stdout
[[ `grep 'INFO' .nextflow.log | grep -E -c '\[skipping\] Stored process > foo'` == 4 ]] || false
grep "Result $PWD/cache/omega/result.txt" stdout
grep "Result $PWD/cache/delta/result.txt" stdout
grep "Result $PWD/cache/alpha/result.txt" stdout
grep "Result $PWD/cache/gamma/result.txt" stdout
test -f my_alpha.txt
test -f my_delta.txt
test -f my_gamma.txt
test -f my_omega.txt
diff my_alpha.txt .expected
diff my_delta.txt .expected
diff my_gamma.txt .expected
diff my_omega.txt .expected
rm my_*
#
# run resume mode
#
echo ''
$NXF_RUN -resume | tee stdout
[[ `grep 'INFO' .nextflow.log | grep -E -c '\[skipping\] Stored process > foo'` == 4 ]] || false
grep "Result $PWD/cache/omega/result.txt" stdout
grep "Result $PWD/cache/delta/result.txt" stdout
grep "Result $PWD/cache/alpha/result.txt" stdout
grep "Result $PWD/cache/gamma/result.txt" stdout
test -f my_alpha.txt
test -f my_delta.txt
test -f my_gamma.txt
test -f my_omega.txt
diff my_alpha.txt .expected
diff my_delta.txt .expected
diff my_gamma.txt .expected
diff my_omega.txt .expected

View File

@@ -0,0 +1,2 @@
Hello
World

View File

@@ -0,0 +1,35 @@
set -e
#
# run normal mode
#
echo ''
$NXF_RUN | tee stdout
[[ `grep 'INFO' .nextflow.log | grep -c 'Submitted process > foo (p1.fa)'` == 1 ]] || false
[[ `grep 'INFO' .nextflow.log | grep -c 'Submitted process > foo (p2.fa)'` == 1 ]] || false
[[ `grep 'INFO' .nextflow.log | grep -c 'Submitted process > foo (p3.fa)'` == 1 ]] || false
[[ `< stdout grep -c '>1ycsB'` == 2 ]] || false
[[ `< stdout grep -c '>1pht'` == 2 ]] || false
[[ `< stdout grep -c '>1aboA'` == 1 ]] || false
[[ `< stdout grep -c '>1ihvA'` == 1 ]] || false
[[ `< stdout grep -c '>1vie'` == 1 ]] || false
#
# run resume mode
#
echo ''
$NXF_RUN -resume | tee stdout
[[ `grep 'INFO' .nextflow.log | grep -c 'Cached process > foo (p1.fa)'` == 1 ]] || false
[[ `grep 'INFO' .nextflow.log | grep -c 'Cached process > foo (p2.fa)'` == 1 ]] || false
[[ `grep 'INFO' .nextflow.log | grep -c 'Cached process > foo (p3.fa)'` == 1 ]] || false
[[ `< stdout grep -c '>1ycsB'` == 2 ]] || false
[[ `< stdout grep -c '>1pht'` == 2 ]] || false
[[ `< stdout grep -c '>1aboA'` == 1 ]] || false
[[ `< stdout grep -c '>1ihvA'` == 1 ]] || false
[[ `< stdout grep -c '>1vie'` == 1 ]] || false

View File

@@ -0,0 +1,77 @@
set -e
export NXF_ANSI_LOG=false
#
# create the `hello.sh` executable script
#
mkdir -p bin
echo "echo Hola mundo" > bin/hello.sh
chmod +x bin/hello.sh
#
# create the nextflow config file
#
cat << EOF > nextflow.config
env.FOO = 'HOLA'
process.container = 'quay.io/nextflow/bash'
EOF
#
# create the nextflow script
#
cat << EOF > foo.nf
process foo {
echo true
input:
env BAR
'''
env | grep -E "^(FOO|BAR)" | sort
hello.sh
'''
}
workflow {
channel.value('Hello World!') | foo
}
EOF
#
# not the testing part
#
# NF plain run
$NXF_CMD run foo.nf | tee stdout
# run tests
[[ `grep 'INFO' .nextflow.log | grep -c 'Submitted process'` == 1 ]] || false
[[ `< stdout grep -c 'FOO=HOLA'` == 1 ]] || false
[[ `< stdout grep -c 'BAR=Hello World!'` == 1 ]] || false
[[ `< stdout grep -c 'Hola mundo'` == 1 ]] || false
# NF run with trace
$NXF_CMD run foo.nf -with-trace | tee stdout
# run tests
[[ `grep 'INFO' .nextflow.log | grep -c 'Submitted process'` == 1 ]] || false
[[ `< stdout grep -c 'FOO=HOLA'` == 1 ]] || false
[[ `< stdout grep -c 'BAR=Hello World!'` == 1 ]] || false
[[ `< stdout grep -c 'Hola mundo'` == 1 ]] || false
# NF run with docker
$NXF_CMD run foo.nf -with-docker | tee stdout
# run tests
[[ `grep 'INFO' .nextflow.log | grep -c 'Submitted process'` == 1 ]] || false
[[ `< stdout grep -c 'FOO=HOLA'` == 1 ]] || false
[[ `< stdout grep -c 'BAR=Hello World!'` == 1 ]] || false
[[ `< stdout grep -c 'Hola mundo'` == 1 ]] || false
# NF run with docker and trace
$NXF_CMD run foo.nf -with-trace -with-docker | tee stdout
# run tests
[[ `grep 'INFO' .nextflow.log | grep -c 'Submitted process'` == 1 ]] || false
[[ `< stdout grep -c 'FOO=HOLA'` == 1 ]] || false
[[ `< stdout grep -c 'BAR=Hello World!'` == 1 ]] || false
[[ `< stdout grep -c 'Hola mundo'` == 1 ]] || false

View File

@@ -0,0 +1,77 @@
set -e
export NXF_ANSI_LOG=false
#
# create the `hello.sh` executable script
#
mkdir -p bin
echo "echo Hola mundo" > bin/hello.sh
chmod +x bin/hello.sh
#
# create the nextflow config file
#
cat << EOF > nextflow.config
env.FOO = 'HOLA'
process.container = 'quay.io/nextflow/bash'
EOF
#
# create the nextflow script
#
cat << EOF > foo.nf
process foo {
echo true
input:
env BAR
'''
env | grep -E "^(FOO|BAR)" | sort
hello.sh
'''
}
workflow {
channel.value('Hello World!') | foo
}
EOF
#
# not the testing part
#
# NF plain run
$NXF_CMD run foo.nf | tee stdout
# run tests
[[ `grep 'INFO' .nextflow.log | grep -c 'Submitted process'` == 1 ]] || false
[[ `< stdout grep -c 'FOO=HOLA'` == 1 ]] || false
[[ `< stdout grep -c 'BAR=Hello World!'` == 1 ]] || false
[[ `< stdout grep -c 'Hola mundo'` == 1 ]] || false
# NF run with trace
$NXF_CMD run foo.nf -with-trace | tee stdout
# run tests
[[ `grep 'INFO' .nextflow.log | grep -c 'Submitted process'` == 1 ]] || false
[[ `< stdout grep -c 'FOO=HOLA'` == 1 ]] || false
[[ `< stdout grep -c 'BAR=Hello World!'` == 1 ]] || false
[[ `< stdout grep -c 'Hola mundo'` == 1 ]] || false
# NF run with docker
$NXF_CMD run foo.nf -with-docker | tee stdout
# run tests
[[ `grep 'INFO' .nextflow.log | grep -c 'Submitted process'` == 1 ]] || false
[[ `< stdout grep -c 'FOO=HOLA'` == 1 ]] || false
[[ `< stdout grep -c 'BAR=Hello World!'` == 1 ]] || false
[[ `< stdout grep -c 'Hola mundo'` == 1 ]] || false
# NF run with docker and trace
$NXF_CMD run foo.nf -with-trace -with-docker | tee stdout
# run tests
[[ `grep 'INFO' .nextflow.log | grep -c 'Submitted process'` == 1 ]] || false
[[ `< stdout grep -c 'FOO=HOLA'` == 1 ]] || false
[[ `< stdout grep -c 'BAR=Hello World!'` == 1 ]] || false
[[ `< stdout grep -c 'Hola mundo'` == 1 ]] || false

View File

@@ -0,0 +1,17 @@
#
# run normal mode
#
$NXF_RUN | tee .stdout
[[ `grep INFO .nextflow.log | grep -c 'Submitted process'` == 2 ]] || false
[[ `< .stdout grep 'bar says Hello'` ]] || false
#
# run resume mode
#
$NXF_RUN -resume | tee .stdout
[[ `grep INFO .nextflow.log | grep -c 'Cached process'` == 2 ]] || false
[[ `< .stdout grep 'bar says Hello'` ]] || false

View File

@@ -0,0 +1,21 @@
set -e
export NXF_ASSETS=$PWD/assets
#
# First run test `success` is `true`
#
set +e
echo ''
$NXF_RUN > stdout
status=$?
set -e
# the exit status must NOT be zero because the pipeline throws an error
[ $status -ne 0 ] || false
[[ `grep 'INFO' .nextflow.log | grep -c 'Submitted process > foo'` == 3 ]] || false
[[ `grep -c 'success: false' stdout` == 1 ]] || false
[[ `grep -c 'exitStatus: 99' stdout` == 1 ]] || false
[[ `grep -c 'run_1' stdout` == 1 ]] || false
[[ `grep -c 'run_2' stdout` == 1 ]] || false

View File

@@ -0,0 +1,13 @@
set -e
set +e
echo ''
$NXF_CMD -q run $NXF_SCRIPT -c .config > stdout
status=$?
set -e
[ $status -ne 0 ] || false
[[ `< .nextflow.log grep -c 'Submitted process > foo'` == 3 ]] || false
[[ `< .nextflow.log grep -c 'Submitted process > bar'` == 1 ]] || false
[[ `< .nextflow.log grep -c 'Error is ignored'` == 1 ]] || false

View File

@@ -0,0 +1,6 @@
workflow {
failOnIgnore = true
}
process {
errorStrategy = 'ignore'
}

View File

@@ -0,0 +1,6 @@
set +e
$NXF_RUN | tee stdout
set -e
< stdout grep "Check script '.*error-message.nf' at line: 19"

View File

@@ -0,0 +1,23 @@
set -e
#
# run normal mode
#
$NXF_RUN -c .config | tee stdout
[[ `grep 'INFO' .nextflow.log | grep -c 'Submitted process > task1'` == 3 ]] || false
[[ `grep 'INFO' .nextflow.log | grep -c 'Submitted process > task2'` == 3 ]] || false
[[ `grep 'NOTE' .nextflow.log | grep -E -c "Process .* terminated with an error exit status"` == 3 ]] || false
#
# RESUME mode
#
echo ''
$NXF_RUN -c .config -resume | tee stdout
[[ `grep 'INFO' .nextflow.log | grep -c 'Submitted process > task1'` == 3 ]] || false
[[ `grep 'INFO' .nextflow.log | grep -c 'Cached process > task2'` == 3 ]] || false
[[ `grep 'NOTE' .nextflow.log | grep -E -c "Process .* terminated with an error exit status"` == 3 ]] || false

View File

@@ -0,0 +1 @@
process.errorStrategy = { task.exitStatus >= 1 ? 'retry' : 'ignore' }

View File

@@ -0,0 +1,24 @@
set -e
mkdir \[work-dir\]
#
# run normal mode
#
$NXF_RUN -w \[work-dir\] | tee stdout
[[ `grep INFO .nextflow.log | grep -c 'Submitted process'` == 1 ]] || false
[[ `< stdout grep -c -F 'match: file[a-b].txt'` == 1 ]] || false
[[ `< stdout grep -c -F 'match: file-*.txt'` == 1 ]] || false
[[ `< stdout grep -c -F 'match: file-?.txt'` == 1 ]] || false
#
# run resume mode
#
$NXF_RUN -w \[work-dir\] -resume | tee stdout
[[ `grep INFO .nextflow.log | grep -c 'Cached process'` == 1 ]] || false
[[ `< stdout grep -c -F 'match: file[a-b].txt'` == 1 ]] || false
[[ `< stdout grep -c -F 'match: file-*.txt'` == 1 ]] || false
[[ `< stdout grep -c -F 'match: file-?.txt'` == 1 ]] || false

View File

@@ -0,0 +1,17 @@
#
# run normal mode
#
$NXF_RUN | tee .stdout
[[ `grep INFO .nextflow.log | grep -c 'Submitted process'` == 1 ]] || false
[[ `< .stdout grep 'GNU bash'` ]] || false
#
# run resume mode
#
$NXF_RUN -resume | tee .stdout
[[ `grep INFO .nextflow.log | grep -c 'Cached process'` == 1 ]] || false
[[ `< .stdout grep 'GNU bash'` ]] || false

View File

@@ -0,0 +1,10 @@
set +e
set -o pipefail
echo ''
echo \$ $NXF_RUN
$NXF_RUN | tee stdout
# must return a non-zero exit status
[[ $? == 0 ]] && exit 1
[[ `<stdout grep -c 'Channel empty terminating'` == 1 ]] || false

View File

@@ -0,0 +1,18 @@
set +e
#
# run normal mode
#
echo ''
$NXF_RUN
[[ $? == 0 ]] && exit 1
#
# RESUME mode
#
echo ''
$NXF_RUN -resume
[[ $? == 0 ]] && exit 1
exit 0

View File

@@ -0,0 +1,21 @@
set -e
export NXF_ANSI_LOG=false
#
# run normal mode
#
echo ''
$NXF_RUN | tee stdout
[[ `grep 'INFO' .nextflow.log | grep -c 'Submitted process > foo'` == 26 ]] || false
cmp stdout .expected || false
#
# RESUME mode
#
echo ''
$NXF_RUN -resume | tee stdout
[[ `grep 'INFO' .nextflow.log | grep -c 'Cached process > foo'` == 26 ]] || false
cmp stdout .expected || false

View File

@@ -0,0 +1,26 @@
[1, a]
[2, b]
[3, c]
[4, d]
[5, e]
[6, f]
[7, g]
[8, h]
[9, i]
[10, j]
[11, k]
[12, l]
[13, m]
[14, n]
[15, o]
[16, p]
[17, q]
[18, r]
[19, s]
[20, t]
[21, u]
[22, v]
[23, w]
[24, x]
[25, y]
[26, z]

View File

@@ -0,0 +1,20 @@
set -e
#
# run normal mode
#
echo ''
$NXF_RUN | tee stdout
[[ `< .nextflow.log grep -c 'Submitted process > foo'` == 1 ]] || false
[[ `< stdout grep -c 'Hello' ` == 1 ]] || false
#
# RESUME mode
#
echo ''
$NXF_RUN -resume | tee stdout
[[ `< .nextflow.log grep -c 'Cached process > foo'` == 1 ]] || false
[[ `< stdout grep -c 'Hello' ` == 1 ]] || false

View File

@@ -0,0 +1,20 @@
set -e
#
# run normal mode
#
echo ''
$NXF_RUN | tee stdout
[[ `< .nextflow.log grep -c 'Submitted process > foo'` == 1 ]] || false
[[ `< stdout grep -c 'Hello' ` == 1 ]] || false
#
# RESUME mode
#
echo ''
$NXF_RUN -resume | tee stdout
[[ `< .nextflow.log grep -c 'Cached process > foo'` == 1 ]] || false
[[ `< stdout grep -c 'Hello' ` == 1 ]] || false

View File

@@ -0,0 +1,25 @@
set -e
#
# run normal mode
#
echo ''
echo \$ $NXF_RUN
$NXF_RUN | tee stdout
[[ `grep 'INFO' .nextflow.log | grep -c 'Submitted process > split'` == 1 ]] || false
[[ `grep 'INFO' .nextflow.log | grep -c 'Submitted process > printTwo'` == 1 ]] || false
[[ `grep 'INFO' .nextflow.log | grep -c 'Submitted process > printLast'` == 2 ]] || false
#
# RESUME mode
#
echo ''
echo \$ $NXF_RUN -resume
$NXF_RUN -resume | tee stdout
[[ `grep 'INFO' .nextflow.log | grep -c 'Cached process > split'` == 1 ]] || false
[[ `grep 'INFO' .nextflow.log | grep -c 'Cached process > printTwo'` == 1 ]] || false
[[ `grep 'INFO' .nextflow.log | grep -c 'Cached process > printLast'` == 2 ]] || false

View File

@@ -0,0 +1,27 @@
#!/bin/bash
# Skip test if AWS keys are missing
if [ -z "$AWS_ACCESS_KEY_ID" ]; then
echo "Missing AWS credentials -- Skipping test"
exit 0
fi
OUTDIR="s3://nextflow-ci/work/ci-test/fusion-symlink/$(uuidgen)"
#
# normal run
#
echo initial run
$NXF_RUN -c .config --outdir "$OUTDIR"
$NXF_CMD fs cp "$OUTDIR/data.txt" data.txt
cmp data.txt .expected || false
#
# resume run
#
echo resumed run
$NXF_RUN -c .config --outdir "$OUTDIR" -resume
$NXF_CMD fs cp "$OUTDIR/data.txt" data.txt
cmp data.txt .expected || false

View File

@@ -0,0 +1,5 @@
workDir = 's3://nextflow-ci/work'
fusion.enabled = true
fusion.exportStorageCredentials = true
wave.enabled = true
docker.runOptions = '-e FUSION_TRACING_DESTINATION=objectstore://'

View File

@@ -0,0 +1 @@
HELLO

View File

@@ -0,0 +1,27 @@
set -e
#
# run normal mode
#
echo ''
$NXF_RUN | tee stdout
[[ `grep 'INFO' .nextflow.log | grep -c 'Submitted process > recurseDir'` == 1 ]] || false
grep 'result1: file2.fa' stdout
grep 'result1: file3.fa' stdout
grep 'result1: file4.fa' stdout
grep 'result2: file5.txt' stdout
#
# run resume mode
#
echo ''
$NXF_RUN -resume | tee stdout
[[ `grep 'INFO' .nextflow.log | grep -c 'Cached process > recurseDir'` == 1 ]] || false
grep 'result1: file2.fa' stdout
grep 'result1: file3.fa' stdout
grep 'result1: file4.fa' stdout
grep 'result2: file5.txt' stdout

View File

@@ -0,0 +1,31 @@
set -e
#
# run normal mode
#
echo ''
$NXF_RUN | tee stdout
[[ `grep 'INFO' .nextflow.log | grep -c 'Submitted process > sayhello'` == 1 ]] || false
[[ `grep -c 'Hello world!' stdout` == 1 ]] || false
#
# RESUME mode
#
echo ''
$NXF_RUN -resume | tee stdout
[[ `grep 'INFO' .nextflow.log | grep -c 'Cached process > sayhello'` == 1 ]] || false
[[ `grep -c 'Hello world!' stdout` == 1 ]] || false
#
# checks reports
#
echo ''
$NXF_RUN -with-report -with-timeline -with-trace -with-dag | tee stdout
[ -s report-*.html ] || false
[ -s timeline-*.html ] || false
[ -s trace-*.txt ] || false
[ -s dag-*.html ] || false

View File

@@ -0,0 +1,28 @@
set -e
#
# run normal mode
#
echo ''
$NXF_RUN | tee stdout
[[ `grep 'INFO' .nextflow.log | grep -c 'Submitted process > foo'` == 2 ]] || false
[[ `grep -c '1 - a' stdout` == 1 ]] || false
[[ `grep -c '1 - b' stdout` == 1 ]] || false
[[ `grep -c 'foo out: a' stdout` == 1 ]] || false
[[ `grep -c 'foo out: b' stdout` == 1 ]] || false
#
# RESUME mode
#
echo ''
$NXF_RUN -resume | tee stdout
[[ `grep 'INFO' .nextflow.log | grep -c 'Cached process > foo'` == 2 ]] || false
[[ `grep -c '1 - a' stdout` == 1 ]] || false
[[ `grep -c '1 - b' stdout` == 1 ]] || false
[[ `grep -c 'foo out: a' stdout` == 1 ]] || false
[[ `grep -c 'foo out: b' stdout` == 1 ]] || false

View File

@@ -0,0 +1,21 @@
set -e
#
# run normal mode
#
echo ''
$NXF_RUN | tee stdout
[[ `grep 'INFO' .nextflow.log | grep -c 'Submitted process > perlTask'` == 1 ]] || false
[[ `grep 'INFO' .nextflow.log | grep -c 'Submitted process > pyTask'` == 1 ]] || false
#
# RESUME mode
#
echo ''
$NXF_RUN -resume | tee stdout
[[ `grep 'INFO' .nextflow.log | grep -c 'Cached process > perlTask'` == 1 ]] || false
[[ `grep 'INFO' .nextflow.log | grep -c 'Cached process > pyTask'` == 1 ]] || false

View File

@@ -0,0 +1 @@
avg: 43.5159945284 - 36.8211561596

View File

@@ -0,0 +1,20 @@
set -e
#
# run normal mode
#
echo ''
$NXF_RUN | tee stdout
[[ `grep 'INFO' .nextflow.log | grep -c 'Submitted process > nativeCode'` == 1 ]] || false
grep 'Hello world' stdout
#
# RESUME mode
#
echo ''
$NXF_RUN -resume | tee stdout
[[ `grep 'INFO' .nextflow.log | grep -c 'Cached process > nativeCode'` == 1 ]] || false
grep 'Hello world' stdout

View File

@@ -0,0 +1,18 @@
set -e
#
# run normal mode
#
echo ''
$NXF_RUN | tee stdout
[[ `< .nextflow.log grep -c 'Submitted process > foo'` == 1 ]] || false
#
# RESUME mode
#
echo ''
$NXF_RUN -resume | tee stdout
[[ `< .nextflow.log grep -c 'Cached process > foo'` == 1 ]] || false

View File

@@ -0,0 +1,78 @@
#
# run normal mode
#
echo First run
$NXF_RUN --save_bam_bai | tee stdout
[[ $(grep INFO .nextflow.log | grep -c 'Submitted process > fastqc') == 3 ]] || false
[[ $(grep INFO .nextflow.log | grep -c 'Submitted process > align') == 3 ]] || false
[[ $(grep INFO .nextflow.log | grep -c 'Submitted process > quant') == 3 ]] || false
[[ -f results/log/alpha.fastqc.log ]] || false
[[ -f results/log/beta.fastqc.log ]] || false
[[ -f results/log/delta.fastqc.log ]] || false
[[ -f results/align/alpha.bai ]] || false
[[ -f results/align/alpha.bam ]] || false
[[ -f results/align/beta.bai ]] || false
[[ -f results/align/beta.bam ]] || false
[[ -f results/align/delta.bai ]] || false
[[ -f results/align/delta.bam ]] || false
[[ -L results/quant/alpha ]] || false
[[ -L results/quant/beta ]] || false
[[ -L results/quant/delta ]] || false
[[ -f results/samples.csv ]] || false
[[ -f results/summary.txt ]] || false
#
# one more time to make sure 'overwrite' is fine
#
echo Second run
$NXF_RUN --save_bam_bai | tee stdout
[[ $(grep INFO .nextflow.log | grep -c 'Submitted process > fastqc') == 3 ]] || false
[[ $(grep INFO .nextflow.log | grep -c 'Submitted process > align') == 3 ]] || false
[[ $(grep INFO .nextflow.log | grep -c 'Submitted process > quant') == 3 ]] || false
[[ -f results/log/alpha.fastqc.log ]] || false
[[ -f results/log/beta.fastqc.log ]] || false
[[ -f results/log/delta.fastqc.log ]] || false
[[ -f results/align/alpha.bai ]] || false
[[ -f results/align/alpha.bam ]] || false
[[ -f results/align/beta.bai ]] || false
[[ -f results/align/beta.bam ]] || false
[[ -f results/align/delta.bai ]] || false
[[ -f results/align/delta.bam ]] || false
[[ -L results/quant/alpha ]] || false
[[ -L results/quant/beta ]] || false
[[ -L results/quant/delta ]] || false
[[ -f results/samples.csv ]] || false
[[ -f results/summary.txt ]] || false
#
# clean & run resume mode
#
echo Third run
rm -rf results
$NXF_RUN --save_bam_bai -resume | tee stdout
[[ $(grep INFO .nextflow.log | grep -c 'Cached process > fastqc') == 3 ]] || false
[[ $(grep INFO .nextflow.log | grep -c 'Cached process > align') == 3 ]] || false
[[ $(grep INFO .nextflow.log | grep -c 'Cached process > quant') == 3 ]] || false
[[ -f results/log/alpha.fastqc.log ]] || false
[[ -f results/log/beta.fastqc.log ]] || false
[[ -f results/log/delta.fastqc.log ]] || false
[[ -f results/align/alpha.bai ]] || false
[[ -f results/align/alpha.bam ]] || false
[[ -f results/align/beta.bai ]] || false
[[ -f results/align/beta.bam ]] || false
[[ -f results/align/delta.bai ]] || false
[[ -f results/align/delta.bam ]] || false
[[ -L results/quant/alpha ]] || false
[[ -L results/quant/beta ]] || false
[[ -L results/quant/delta ]] || false
[[ -f results/samples.csv ]] || false
[[ -f results/summary.txt ]] || false

View File

@@ -0,0 +1,25 @@
set -e
#
# run normal mode
#
echo ''
$NXF_RUN | tee stdout
[[ `grep 'INFO' .nextflow.log | grep -c 'Submitted process > foo'` == 1 ]] || false
[[ `< stdout grep 'dummy'` ]] || false
#
# RESUME mode
#
echo ''
$NXF_RUN -resume | tee stdout
[[ `grep 'INFO' .nextflow.log | grep -c 'Cached process > foo'` == 1 ]] || false
[[ `< stdout grep 'dummy'` ]] || false

View File

@@ -0,0 +1,28 @@
set -e
#
# run normal mode
#
echo ''
$NXF_RUN | tee stdout
[[ `grep 'INFO' .nextflow.log | grep -c 'Submitted process > foo'` == 1 ]] || false
[[ `grep 'INFO' .nextflow.log | grep -c 'Submitted process > bar'` == 1 ]] || false
[[ `< stdout grep -E 'foo.*/a/a/2\.txt' ` ]] || false
[[ `< stdout grep -E 'bar.*/a/a/2\.txt' ` ]] || false
#
# RESUME mode
#
echo ''
$NXF_RUN -resume | tee stdout
[[ `grep 'INFO' .nextflow.log | grep -c 'Cached process > foo'` == 1 ]] || false
[[ `grep 'INFO' .nextflow.log | grep -c 'Cached process > bar'` == 1 ]] || false
[[ `< stdout grep -E 'foo.*/a/a/2\.txt' ` ]] || false
[[ `< stdout grep -E 'bar.*/a/a/2\.txt' ` ]] || false

View File

@@ -0,0 +1,18 @@
set -e
#
# run normal mode
#
$NXF_RUN -process.scratch true | tee stdout
[[ `grep INFO .nextflow.log | grep -c 'Submitted process'` == 1 ]] || false
#
# run resume mode
#
$NXF_RUN -resume -process.scratch true | tee stdout
[[ `grep INFO .nextflow.log | grep -c 'Cached process'` == 1 ]] || false

View File

@@ -0,0 +1,30 @@
set -e
#
# run normal mode
#
echo ''
$NXF_RUN | tee stdout
[[ `grep 'INFO' .nextflow.log | grep -c 'Submitted process > foo'` == 1 ]] || false
[[ `< stdout grep 'x: 100'` ]] || false
[[ `< stdout grep 'y: two hundred'` ]] || false
[[ `< stdout grep 'str: Hello'` ]] || false
[[ `< stdout grep 'exp: prot-100.out'` ]] || false
#
# RESUME mode
#
echo ''
$NXF_RUN -resume | tee stdout
[[ `grep 'INFO' .nextflow.log | grep -c 'Cached process > foo'` == 1 ]] || false
[[ `< stdout grep 'x: 100'` ]] || false
[[ `< stdout grep 'y: two hundred'` ]] || false
[[ `< stdout grep 'str: Hello'` ]] || false
[[ `< stdout grep 'exp: prot-100.out'` ]] || false

View File

@@ -0,0 +1,4 @@
$NXF_RUN | tee stdout
[[ `< stdout grep -c 'User-agent'` != 0 ]] || false
[[ `< stdout grep -c 'Disallow'` != 0 ]] || false

View File

@@ -0,0 +1,16 @@
set +e
#
# run normal mode
#
echo ''
$NXF_RUN
[[ $? == 0 ]] || false
#
# RESUME mode
#
echo ''
$NXF_RUN -resume
[[ $? == 0 ]] || false

View File

@@ -0,0 +1,43 @@
#
# verify default profile
#
$NXF_CMD -C ../../profiles.config config | tee stdout
cmp stdout .expected_profile_standard.txt || false
#
# verify advanced profile
#
$NXF_CMD -C ../../profiles.config config -profile advanced | tee stdout
cmp stdout .expected_profile_advanced.txt || false
#
# verify *all* profile
#
$NXF_CMD -C ../../profiles.config config -a | tee stdout
cmp stdout .expected_profile_all.txt || false
#
# verify return error
#
$NXF_CMD -C ../../profiles.config config -profile xxx 2>&1| tee stdout
[[ ${PIPESTATUS[0]} == 0 ]] && exit 1
< stdout grep "Unknown configuration profile: 'xxx'" || false
#
# Verify run uses the default profile
#
$NXF_CMD -C ../../profiles.config run $NXF_SCRIPT | tee stdout
< stdout grep "cpus: 2 memory: 2 GB" || false
#
# Verify run uses the *advanced* profile
#
$NXF_CMD -C ../../profiles.config run $NXF_SCRIPT -profile advanced | tee stdout
< stdout grep "cpus: 8 memory: 10 GB" || false
#
# Verify that return an error code
#
$NXF_CMD -C ../../profiles.config run $NXF_SCRIPT -profile foo 2>&1| tee stdout
[[ ${PIPESTATUS[0]} == 0 ]] && exit 1
< stdout grep "Unknown configuration profile: 'foo'" || false

View File

@@ -0,0 +1,8 @@
echo = true
foo = 'bar'
process {
cpus = 8
memory = '10GB'
disk = '300GB'
}

View File

@@ -0,0 +1,18 @@
echo = true
foo = 'bar'
profiles {
standard {
process {
cpus = 2
memory = '2GB'
}
}
advanced {
process {
cpus = 8
memory = '10GB'
disk = '300GB'
}
}
}

View File

@@ -0,0 +1,7 @@
echo = true
foo = 'bar'
process {
cpus = 2
memory = '2GB'
}

View File

@@ -0,0 +1,10 @@
$NXF_RUN | tee stdout
[[ `< stdout grep -c 'exit_status=0'` != 0 ]] || false
[[ `< stdout grep -c 'record=aaa_bbb'` != 0 ]] || false
$NXF_RUN -resume | tee stdout
[[ `< stdout grep -c 'exit_status=0'` != 0 ]] || false
[[ `< stdout grep -c 'record=aaa_bbb'` != 0 ]] || false

View File

@@ -0,0 +1,73 @@
#
# run normal mode
#
echo First run
$NXF_RUN | tee stdout
[[ `grep INFO .nextflow.log | grep -c 'Submitted process > align'` == 3 ]] || false
[[ `grep INFO .nextflow.log | grep -c 'Submitted process > my_combine'` == 1 ]] || false
cmp stdout .expected || false
[[ -f data/alpha.bai ]] || false
[[ -f data/alpha.bam ]] || false
[[ -f data/beta.bai ]] || false
[[ -f data/beta.bam ]] || false
[[ -f data/delta.bai ]] || false
[[ -f data/delta.bam ]] || false
[[ -L data/result.txt ]] || false
[[ -f more/data/result.txt ]] || false
[[ -f data/xxx/A ]] || false
[[ -f data/xxx/B ]] || false
[[ -f data/xxx/C ]] || false
#
# one more time to make sure 'overwrite' is fine
#
echo Second run
$NXF_RUN | tee stdout
[[ `grep INFO .nextflow.log | grep -c 'Submitted process > align'` == 3 ]] || false
[[ `grep INFO .nextflow.log | grep -c 'Submitted process > my_combine'` == 1 ]] || false
cmp stdout .expected || false
[[ -f data/alpha.bai ]] || false
[[ -f data/alpha.bam ]] || false
[[ -f data/beta.bai ]] || false
[[ -f data/beta.bam ]] || false
[[ -f data/delta.bai ]] || false
[[ -f data/delta.bam ]] || false
[[ -L data/result.txt ]] || false
[[ -f more/data/result.txt ]] || false
[[ -f data/xxx/A ]] || false
[[ -f data/xxx/B ]] || false
[[ -f data/xxx/C ]] || false
#
# clean & run resume mode
#
echo Third run
rm -rf data
rm -rf more/data
$NXF_RUN -resume | tee stdout
[[ `grep INFO .nextflow.log | grep -c 'Cached process > align'` == 3 ]] || false
[[ `grep INFO .nextflow.log | grep -c 'Cached process > my_combine'` == 1 ]] || false
cmp stdout .expected || false
[[ -f data/alpha.bai ]] || false
[[ -f data/alpha.bam ]] || false
[[ -f data/beta.bai ]] || false
[[ -f data/beta.bam ]] || false
[[ -f data/delta.bai ]] || false
[[ -f data/delta.bam ]] || false
[[ -L data/result.txt ]] || false
[[ -f more/data/result.txt ]] || false
#
# NOTE: on Mac when deleting an hard-link also the origin is removed
#
[[ -f data/xxx/A ]] || false
[[ -f data/xxx/B ]] || false
[[ -f data/xxx/C ]] || false

View File

@@ -0,0 +1,7 @@
alpha
beta
delta
ahpla
ateb
atled

View File

@@ -0,0 +1,20 @@
#
# run normal mode
#
echo First run
$NXF_RUN --x ciao | tee stdout
[[ `grep INFO .nextflow.log | grep -c 'Submitted process > foo'` == 1 ]] || false
[[ $(cat data/a/b/c/file.txt) == ciao ]] || false
#
# second run, must overwrite the file
#
echo First run
$NXF_RUN --x miao | tee stdout
[[ `grep INFO .nextflow.log | grep -c 'Submitted process > foo'` == 1 ]] || false
[[ $(cat data/a/b/c/file.txt) == miao ]] || false

View File

@@ -0,0 +1,30 @@
#!/bin/bash
BUCKET="nf-kms-xyz"
PREFIX="work/ci-test/publish-s3/$(uuidgen)"
OUTDIR="s3://$BUCKET/$PREFIX"
function check_kms_key() {
aws s3api head-object --bucket "$BUCKET" --key "$PREFIX/HELLO.tsv" | grep -c e5109f93-b42d-4c26-89ee-8b251029a41d
}
# Skip test if AWS keys are missing
if [ -z "$AWS_ACCESS_KEY_ID" ]; then
echo "Missing AWS credentials -- Skipping test"
exit 0
fi
#
# run normal mode
#
$NXF_RUN -c .config --outdir "$OUTDIR" | tee .stdout
[[ $(grep INFO .nextflow.log | grep -c 'Submitted process') == 1 ]] || false
[[ $(check_kms_key) == 1 ]] || false
#
# run resume mode
#
$NXF_RUN -c .config --outdir "$OUTDIR" -resume | tee .stdout
[[ $(grep INFO .nextflow.log | grep -c 'Cached process') == 1 ]] || false
[[ $(check_kms_key) == 1 ]] || false

View File

@@ -0,0 +1,2 @@
aws.client.storageEncryption = 'aws:kms'
aws.client.storageKmsKeyId = 'arn:aws:kms:eu-west-1:195996028523:key/e5109f93-b42d-4c26-89ee-8b251029a41d'

View File

@@ -0,0 +1,24 @@
function count_hello() {
rm -rf hello
aws s3 cp --only-show-errors s3://nextflow-ci/work/ci-test/publish-s3/HELLO.tsv hello && < hello grep 'Hello, world' -c
}
# Skip test if AWS keys are missing
if [ -z "$AWS_ACCESS_KEY_ID" ]; then
echo "Missing AWS credentials -- Skipping test"
exit 0
fi
#
# run normal mode
#
$NXF_RUN | tee .stdout
[[ `grep INFO .nextflow.log | grep -c 'Submitted process'` == 1 ]] || false
#
# run resume mode
#
$NXF_RUN -resume | tee .stdout
[[ `grep INFO .nextflow.log | grep -c 'Cached process'` == 1 ]] || false

View File

@@ -0,0 +1,11 @@
echo First run
$NXF_RUN | tee stdout
[[ `grep INFO .nextflow.log | grep -c 'Submitted process'` == 3 ]] || false
[[ -f results/alpha/file_1.txt ]] || false
[[ -f results/gamma/file_3.txt ]] || false
[[ ! -f results/file_2.txt ]] || false
[[ ! -f results/alpha/file_2.txt ]] || false
[[ ! -f results/gamma/file_2.txt ]] || false

View File

@@ -0,0 +1,7 @@
#!/bin/bash
launch_cmd=../../launch.sh
export NXF_ANSI_LOG=false
export WITH_DOCKER=${WITH_DOCKER:=''}
export NXF_CMD=$(realpath $launch_cmd)
export TEST_JDK=17
bash run.sh "$1"

View File

@@ -0,0 +1,24 @@
#
# run normal mode
#
$NXF_RUN
[[ `grep INFO .nextflow.log | grep -c 'Submitted process > proc1'` == 3 ]] || false
[[ `grep INFO .nextflow.log | grep -c 'Submitted process > proc2'` == 3 ]] || false
[[ `grep INFO .nextflow.log | grep -c 'Submitted process > proc3'` == 3 ]] || false
[[ `grep INFO .nextflow.log | grep -c 'Submitted process > proc4'` == 3 ]] || false
[[ `grep INFO .nextflow.log | grep -c 'Submitted process > proc5'` == 3 ]] || false
[[ `grep INFO .nextflow.log | grep -c 'Submitted process > proc6'` == 3 ]] || false
[[ `grep INFO .nextflow.log | grep -c 'Submitted process > proc7'` == 3 ]] || false
$NXF_RUN
[[ `grep INFO .nextflow.log | grep -c '\[skipping\] Stored process > proc1'` == 3 ]] || false
[[ `grep INFO .nextflow.log | grep -c '\[skipping\] Stored process > proc2'` == 3 ]] || false
[[ `grep INFO .nextflow.log | grep -c '\[skipping\] Stored process > proc3'` == 3 ]] || false
[[ `grep INFO .nextflow.log | grep -c '\[skipping\] Stored process > proc4'` == 3 ]] || false
[[ `grep INFO .nextflow.log | grep -c '\[skipping\] Stored process > proc5'` == 3 ]] || false
[[ `grep INFO .nextflow.log | grep -c '\[skipping\] Stored process > proc6'` == 3 ]] || false
[[ `grep INFO .nextflow.log | grep -c '\[skipping\] Stored process > proc7'` == 3 ]] || false

View File

@@ -0,0 +1,58 @@
set -e
#
# run normal mode
#
echo ''
$NXF_RUN | tee stdout
[[ `grep 'INFO' .nextflow.log | grep -c 'Submitted process > hola'` == 12 ]] || false
[[ `grep 'INFO' .nextflow.log | grep -c 'Submitted process > foo'` == 2 ]] || false
grep 'x: 1; y: Ciao; z: alpha' stdout
grep 'x: 1; y: Ciao; z: beta' stdout
grep 'x: 1; y: Ciao; z: delta' stdout
grep 'x: 1; y: Hola; z: alpha' stdout
grep 'x: 1; y: Hola; z: beta' stdout
grep 'x: 1; y: Hola; z: delta' stdout
grep 'x: 2; y: Ciao; z: alpha' stdout
grep 'x: 2; y: Ciao; z: beta' stdout
grep 'x: 2; y: Ciao; z: delta' stdout
grep 'x: 2; y: Hola; z: alpha' stdout
grep 'x: 2; y: Hola; z: beta' stdout
grep 'x: 2; y: Hola; z: delta' stdout
grep -F 'foo [a, b]' stdout
grep -F 'foo [c, d]' stdout
#
# RESUME mode
#
echo ''
$NXF_RUN -resume | tee stdout
[[ `grep 'INFO' .nextflow.log | grep -c 'Cached process > hola'` == 12 ]] || false
[[ `grep 'INFO' .nextflow.log | grep -c 'Cached process > foo'` == 2 ]] || false
grep 'x: 1; y: Ciao; z: alpha' stdout
grep 'x: 1; y: Ciao; z: beta' stdout
grep 'x: 1; y: Ciao; z: delta' stdout
grep 'x: 1; y: Hola; z: alpha' stdout
grep 'x: 1; y: Hola; z: beta' stdout
grep 'x: 1; y: Hola; z: delta' stdout
grep 'x: 2; y: Ciao; z: alpha' stdout
grep 'x: 2; y: Ciao; z: beta' stdout
grep 'x: 2; y: Ciao; z: delta' stdout
grep 'x: 2; y: Hola; z: alpha' stdout
grep 'x: 2; y: Hola; z: beta' stdout
grep 'x: 2; y: Hola; z: delta' stdout
grep -F 'foo [a, b]' stdout
grep -F 'foo [c, d]' stdout

View File

@@ -0,0 +1,18 @@
set -e
#
# run normal mode
#
echo ''
$NXF_RUN | tee stdout
[[ `< .nextflow.log grep -c 'Submitted process > foo'` == 1 ]] || false
[[ `< .nextflow.log grep -c 'Re-submitted process > foo'` == 2 ]] || false
#
# RESUME mode
#
echo ''
$NXF_RUN -resume | tee stdout
[[ `< .nextflow.log grep -c 'Cached process > foo'` == 1 ]] || false

View File

@@ -0,0 +1,13 @@
set -e
#
# run normal mode
#
echo ''
$NXF_RUN | tee stdout
[[ `< .nextflow.log grep -c 'Submitted process > foo'` == 1 ]] || false
[[ `< .nextflow.log grep -c 'Re-submitted process > foo'` == 1 ]] || false
[[ `< .nextflow.log grep -c 'Error is ignored'` == 1 ]] || false

100
nextflow/tests-v1/checks/run.sh Executable file
View File

@@ -0,0 +1,100 @@
#!/bin/bash
set -u
trap "exit" INT
NORMAL=$(tput sgr0)
GREEN=$(tput setaf 2; tput bold)
YELLOW=$(tput setaf 3)
RED=$(tput setaf 1)
function echo_red() {
echo -e "$RED$*$NORMAL"
}
function echo_green() {
echo -e "$GREEN$*$NORMAL"
}
function echo_yellow() {
echo -e "$YELLOW$*$NORMAL"
}
#
# Some vars
#
NXF_CMD=${NXF_CMD:-nextflow}
NXF_SYNTAX_PARSER=v1
REPORT=$PWD/.report
WITH_DOCKER=${WITH_DOCKER:=''}
#
# Clean scratch dir
#
export NXF_WORK=$PWD/scratch
rm -rf $NXF_WORK
function run_checks() {
NXF_SCRIPT="../../$1"
NXF_RUN="$NXF_CMD -q run $NXF_SCRIPT"
export NXF_SCRIPT
export NXF_CMD
export NXF_RUN
set +e
if [ -f $1/.checks ]; then
cd $basename;
rm -rf *
bash -ex .checks &> checks.out
else
mkdir -p $1
cd $1
$NXF_RUN > checks.out
fi
ret=$?
set -e
if [[ $ret != 0 ]]; then
echo "~ Test '$1' run failed" >> $REPORT
# dump error output
[[ -s checks.out ]] && cat checks.out | sed 's/^/ /'>> $REPORT
echo '' >> $REPORT
# dump nextflow log file
[[ -f .nextflow.log ]] && cat .nextflow.log >> $REPORT
echo '' >> $REPORT
exit 1
fi
}
rm -rf $REPORT
list=${1:-'../*.nf'}
function can_run() {
if [[ $(grep -c "$1" .PARSER-V1) != 0 ]]; then
echo 'yes'
else
echo 'no'
fi
}
for x in $list; do
basename=$(basename $x)
if [[ $(can_run $basename) == 'yes' ]]; then
echo "> Running test: $basename"
( set -e;
run_checks $basename
)
else
echo "- Ignoring test: $basename"
fi
done
if [[ -s $REPORT ]]; then
echo -e "$RED"
cat $REPORT
echo -e "$NORMAL"
exit 1
fi

View File

@@ -0,0 +1,32 @@
set -e
export NXF_PLUGINS_DEFAULT=nf-amazon
# Skip test if AWS keys are missing
if [[ ! $AWS_ACCESS_KEY_ID ]]; then
echo "Skip s3-files test since AWS keys are not available"
exit 0
fi
#
# run normal mode
#
$NXF_RUN | tee stdout
[[ `grep INFO .nextflow.log | grep -c 'Submitted process > foo'` == 1 ]] || false
[[ `grep INFO .nextflow.log | grep -c 'Submitted process > bar (gut)'` == 1 ]] || false
[[ `grep INFO .nextflow.log | grep -c 'Submitted process > bar (liver)'` == 1 ]] || false
[[ `grep INFO .nextflow.log | grep -c 'Submitted process > bar (lung)'` == 1 ]] || false
cmp stdout .expected || false
#
# run resume mode
#
$NXF_RUN -resume | tee stdout
[[ `grep INFO .nextflow.log | grep -c 'Cached process > foo'` == 1 ]] || false
[[ `grep INFO .nextflow.log | grep -c 'Cached process > bar (gut)'` == 1 ]] || false
[[ `grep INFO .nextflow.log | grep -c 'Cached process > bar (liver)'` == 1 ]] || false
[[ `grep INFO .nextflow.log | grep -c 'Cached process > bar (lung)'` == 1 ]] || false
cmp stdout .expected || false

View File

@@ -0,0 +1,10 @@
>1 dna:chromosome chromosome:Galgal4:1:48849500:49020500:1
TGAAGCTTATCGTGTACTCTGTCTTCAGAAGCACAAGGACAATTAACATTCAATAGCAAG
GTCCTGTATTTATTTGTCTGAATAAATAAATAAGCATAATATATAATAAATAAATACTAT
TCAGCCTCTCACCAATAACAATAGTACCCACGCACATATTGCATAATTACAAAACATCCT
GACAGATCTGTGTGGGTGATAGACCAGAAATACCAGCTCAAATTAACTCTACAAAGAACT
ATATCATGGAACTTAGTGAAAAGTGATTTTTGGTTCCTGATTCTATGGCGCTTTGTTCTG
ACCTCTGTTTCATTGGATAATAAACAACCAGACTAGATTAAACAGTGTGTATTTGAAACA
GAAAATCAGTATAGACTTCCTGATTGAAATCTATTCTCAATCTTCTGGAATGCTCAAAGA
TACTCAGGAATAGAAATTGGAAGAGCAAAAATATCGACAAATTTGTTCCATGAGCTCCCT
CAACCTTTGTAAGATTACTCTCTGTGCAGTAGTTTTCTAGTCCTTTTTCAGTGGTTGATG

View File

@@ -0,0 +1,18 @@
set -e
# enable amazon plugin
export NXF_PLUGINS_DEFAULT=nf-amazon
# this test needs to validate the ability to access S3 public data
# in anonymous manner, therefore make sure to clear any aws credentials
unset AWS_ACCESS_KEY_ID
unset AWS_SECRET_ACCESS_KEY
unset AWS_SECRET_KEY
unset AWS_ACCESS_KEY
#
# run normal mode
#
$NXF_RUN | tee stdout
[[ `grep INFO .nextflow.log | grep -c 'Submitted process > foo'` == 1 ]] || false

View File

@@ -0,0 +1,17 @@
set -e
export NXF_PLUGINS_DEFAULT=nf-amazon
# Skip test if AWS keys are missing
if [[ ! $AWS_ACCESS_KEY_ID ]]; then
echo "Skip s3-files test since AWS keys are not available"
exit 0
fi
#
# run normal mode
#
$NXF_CMD -trace com.upplication.s3fs run nextflow-io/hello \
-with-trace s3://nextflow-ci/test/trace.txt \
-with-report s3://nextflow-ci/test/report.html \
| tee stdout

View File

@@ -0,0 +1,37 @@
#
# run normal mode
#
$NXF_RUN | tee stdout
[[ `grep INFO .nextflow.log | grep -c 'Submitted process'` == 2 ]] || false
< stdout grep "Home: $HOME - Input: alpha zzz" || false
< stdout grep "Home: $HOME - Input: omega zzz" || false
#
# run resume mode
#
$NXF_RUN -resume | tee stdout
[[ `grep INFO .nextflow.log | grep -c 'Cached process'` == 2 ]] || false
< stdout grep "Home: $HOME - Input: alpha zzz" || false
< stdout grep "Home: $HOME - Input: omega zzz" || false
#
# run changing params does not hit cache
#
$NXF_RUN -resume --data xxx | tee stdout
[[ `grep INFO .nextflow.log | grep -c 'Submitted process'` == 2 ]] || false
< stdout grep "Home: $HOME - Input: alpha xxx" || false
< stdout grep "Home: $HOME - Input: omega xxx" || false
#
# now cache is ok
#
$NXF_RUN -resume --data xxx | tee stdout
[[ `grep INFO .nextflow.log | grep -c 'Cached process'` == 2 ]] || false
< stdout grep "Home: $HOME - Input: alpha xxx" || false
< stdout grep "Home: $HOME - Input: omega xxx" || false

View File

@@ -0,0 +1,29 @@
#
# run normal mode
#
echo ''
$NXF_RUN -process.debug | tee stdout
[[ `< .nextflow.log grep -c 'Submitted process > foo'` == 1 ]] || false
[[ `< .nextflow.log grep -c 'Submitted process > bar (1)'` == 1 ]] || false
[[ `< .nextflow.log grep -c 'Submitted process > bar (2)'` == 1 ]] || false
[[ `< .nextflow.log grep -c 'Submitted process > bar (3)'` == 1 ]] || false
[[ `< stdout grep -c 'Hello1'` == 1 ]] || false
[[ `< stdout grep -c 'Hello2'` == 1 ]] || false
[[ `< stdout grep -c 'Hello3'` == 1 ]] || false
#
# RESUME mode
#
echo ''
$NXF_RUN -resume -process.debug | tee stdout
[[ `< .nextflow.log grep -c 'Cached process > foo'` == 1 ]] || false
[[ `< .nextflow.log grep -c 'Cached process > bar (1)'` == 1 ]] || false
[[ `< .nextflow.log grep -c 'Cached process > bar (2)'` == 1 ]] || false
[[ `< .nextflow.log grep -c 'Cached process > bar (3)'` == 1 ]] || false
[[ `< stdout grep -c 'Hello1'` == 1 ]] || false
[[ `< stdout grep -c 'Hello2'` == 1 ]] || false
[[ `< stdout grep -c 'Hello3'` == 1 ]] || false

View File

@@ -0,0 +1,26 @@
set -e
#
# run normal mode
#
echo ''
$NXF_RUN | tee stdout
[[ `grep 'INFO' .nextflow.log | grep -c 'Submitted process > splitLetters'` == 1 ]] || false
[[ `grep 'INFO' .nextflow.log | grep -c 'Submitted process > massage'` == 2 ]] || false
grep 'HELLO' stdout
grep 'WORLD!' stdout
#
# RESUME mode
#
echo ''
$NXF_RUN -resume | tee stdout
[[ `grep 'INFO' .nextflow.log | grep -c 'Cached process > splitLetters'` == 1 ]] || false
[[ `grep 'INFO' .nextflow.log | grep -c 'Cached process > massage'` == 2 ]] || false
grep 'HELLO' stdout
grep 'WORLD!' stdout

View File

@@ -0,0 +1,23 @@
set -e
#
# run normal mode
#
echo ''
NXF_WRAPPER_STAGE_FILE_THRESHOLD='100' $NXF_RUN | tee stdout
[[ `grep 'INFO' .nextflow.log | grep -c 'Submitted process'` == 2 ]] || false
TASK_DIR=`$NXF_CMD log last -F "process == 'bar'"`
[[ `cat $TASK_DIR/.command.stage | wc -l` -eq 19 ]] || false
#
# RESUME mode
#
echo ''
NXF_WRAPPER_STAGE_FILE_THRESHOLD='100' $NXF_RUN -resume | tee stdout
[[ `grep 'INFO' .nextflow.log | grep -c 'Cached process'` == 2 ]] || false
TASK_DIR=`$NXF_CMD log last -F "process == 'bar'"`
[[ `cat $TASK_DIR/.command.stage | wc -l` -eq 19 ]] || false

View File

@@ -0,0 +1,39 @@
set -e
#
# run normal mode
#
echo ''
$NXF_RUN | tee stdout
[[ `grep 'INFO' .nextflow.log | grep -c 'Submitted process > storeCache'` == 3 ]] || false
grep 'cache/Ciao.txt' stdout
grep 'cache/Hola.txt' stdout
grep 'cache/Hello.txt' stdout
#
# run normal mode
#
echo ''
$NXF_RUN | tee stdout
[[ `grep 'INFO' .nextflow.log | grep -c 'Stored process > storeCache'` == 3 ]] || false
grep 'cache/Ciao.txt' stdout
grep 'cache/Hola.txt' stdout
grep 'cache/Hello.txt' stdout
#
# run resume mode
#
echo ''
$NXF_RUN -resume| tee stdout
[[ `grep 'INFO' .nextflow.log | grep -c 'Stored process > storeCache'` == 3 ]] || false
grep 'cache/Ciao.txt' stdout
grep 'cache/Hola.txt' stdout
grep 'cache/Hello.txt' stdout

View File

@@ -0,0 +1,11 @@
set -e
echo ''
$NXF_RUN -stub | tee stdout
[[ `grep 'INFO' .nextflow.log | grep -c 'Submitted process > stubtest'` == 1 ]] || false
[[ `grep 'INFO' .nextflow.log | grep -c 'Re-submitted process > stubtest'` == 1 ]] || false
[[ `grep -c 'Stubbing. Creating file' stdout` == 1 ]] || false

View File

@@ -0,0 +1,27 @@
set -e
#
# run normal mode
#
$NXF_RUN | tee stdout
[[ `grep INFO .nextflow.log | grep -c 'Submitted process'` == 1 ]] || false
< stdout grep 'link_1.fasta'
< stdout grep 'link_2.fasta'
< stdout grep 'link_3.fasta'
< stdout grep 'alpha.txt'
< stdout grep 'beta.txt'
#
# run resume mode
#
$NXF_RUN -resume | tee stdout
[[ `grep INFO .nextflow.log | grep -c 'Cached process'` == 1 ]] || false
< stdout grep 'link_1.fasta'
< stdout grep 'link_2.fasta'
< stdout grep 'link_3.fasta'
< stdout grep 'alpha.txt'
< stdout grep 'beta.txt'

View File

@@ -0,0 +1,19 @@
set -e
rm * || true
$NXF_RUN | tee stdout
[[ `grep INFO .nextflow.log | grep -c 'process > flow1:foo'` == 1 ]] || false
[[ `grep INFO .nextflow.log | grep -c 'process > flow1:bar'` == 1 ]] || false
[[ `grep INFO .nextflow.log | grep -c 'process > flow2:foo'` == 1 ]] || false
[[ `grep INFO .nextflow.log | grep -c 'process > flow2:bar'` == 1 ]] || false
rm * || true
$NXF_RUN -resume | tee stdout
[[ `grep INFO .nextflow.log | grep -c 'Cached process > flow1:foo'` == 1 ]] || false
[[ `grep INFO .nextflow.log | grep -c 'Cached process > flow1:bar'` == 1 ]] || false
[[ `grep INFO .nextflow.log | grep -c 'Cached process > flow2:foo'` == 1 ]] || false
[[ `grep INFO .nextflow.log | grep -c 'Cached process > flow2:bar'` == 1 ]] || false

View File

@@ -0,0 +1,36 @@
set -e
rm * || true
$NXF_RUN | tee stdout
[[ `grep INFO .nextflow.log | grep -c 'process > test1:flow1:foo'` == 1 ]] || false
[[ `grep INFO .nextflow.log | grep -c 'process > test1:flow1:bar'` == 1 ]] || false
[[ `grep INFO .nextflow.log | grep -c 'process > test1:flow2:foo'` == 1 ]] || false
[[ `grep INFO .nextflow.log | grep -c 'process > test1:flow2:baz'` == 1 ]] || false
[[ `grep INFO .nextflow.log | grep -c 'process > test2:flow1:foo'` == 1 ]] || false
[[ `grep INFO .nextflow.log | grep -c 'process > test2:flow1:bar'` == 1 ]] || false
[[ `grep INFO .nextflow.log | grep -c 'process > test2:flow2:foo'` == 1 ]] || false
[[ `grep INFO .nextflow.log | grep -c 'process > test2:flow2:baz'` == 1 ]] || false
[[ `<test1.txt grep -c 'HELLO'` == 1 ]]
[[ `<test1.txt grep -c 'olleH'` == 1 ]]
[[ `<test2.txt grep -c 'HELLO'` == 1 ]]
[[ `<test2.txt grep -c 'olleH'` == 1 ]]
rm * || true
$NXF_RUN -resume | tee stdout
[[ `grep INFO .nextflow.log | grep -c 'Cached process > test1:flow1:foo'` == 1 ]] || false
[[ `grep INFO .nextflow.log | grep -c 'Cached process > test1:flow1:bar'` == 1 ]] || false
[[ `grep INFO .nextflow.log | grep -c 'Cached process > test1:flow2:foo'` == 1 ]] || false
[[ `grep INFO .nextflow.log | grep -c 'Cached process > test1:flow2:baz'` == 1 ]] || false
[[ `grep INFO .nextflow.log | grep -c 'Cached process > test2:flow1:foo'` == 1 ]] || false
[[ `grep INFO .nextflow.log | grep -c 'Cached process > test2:flow1:bar'` == 1 ]] || false
[[ `grep INFO .nextflow.log | grep -c 'Cached process > test2:flow2:foo'` == 1 ]] || false
[[ `grep INFO .nextflow.log | grep -c 'Cached process > test2:flow2:baz'` == 1 ]] || false
[[ `<test1.txt grep -c 'HELLO'` == 1 ]]
[[ `<test1.txt grep -c 'olleH'` == 1 ]]
[[ `<test2.txt grep -c 'HELLO'` == 1 ]]
[[ `<test2.txt grep -c 'olleH'` == 1 ]]

View File

@@ -0,0 +1,21 @@
set -e
#
# run normal mode
#
echo ''
$NXF_RUN -c ../../tag-resume.config | tee stdout
grep -c 'Submitted process > test (My Tool)' .nextflow.log
grep 'Hola' stdout
#
# run resume mode
#
echo ''
$NXF_RUN -c ../../tag-resume.config -resume| tee stdout
grep -c 'Cached process > test (My Tool)' .nextflow.log
grep 'Hola' stdout

View File

@@ -0,0 +1,34 @@
set -e
#
# run normal mode
#
echo ''
$NXF_RUN | tee stdout
grep -c 'Submitted process > foo (alpha.fastq)' .nextflow.log
grep -c 'Submitted process > foo (delta.fastq)' .nextflow.log
grep -c 'Submitted process > foo (gamma.fastq)' .nextflow.log
grep -c 'Submitted process > foo (omega.fastq)' .nextflow.log
grep 'alpha' stdout
grep 'delta' stdout
grep 'gamma' stdout
grep 'omega' stdout
#
# run resume mode
#
echo ''
$NXF_RUN -resume| tee stdout
grep -c 'Cached process > foo (alpha.fastq)' .nextflow.log
grep -c 'Cached process > foo (delta.fastq)' .nextflow.log
grep -c 'Cached process > foo (gamma.fastq)' .nextflow.log
grep -c 'Cached process > foo (omega.fastq)' .nextflow.log
grep 'alpha' stdout
grep 'delta' stdout
grep 'gamma' stdout
grep 'omega' stdout

View File

@@ -0,0 +1,34 @@
set -e
#
# run normal mode
#
echo ''
$NXF_RUN | tee stdout
grep -c 'Submitted process > foo (alpha)' .nextflow.log
grep -c 'Submitted process > foo (delta)' .nextflow.log
grep -c 'Submitted process > foo (gamma)' .nextflow.log
grep -c 'Submitted process > foo (omega)' .nextflow.log
grep 'alpha' stdout
grep 'delta' stdout
grep 'gamma' stdout
grep 'omega' stdout
#
# run resume mode
#
echo ''
$NXF_RUN -resume| tee stdout
grep -c 'Cached process > foo (alpha)' .nextflow.log
grep -c 'Cached process > foo (delta)' .nextflow.log
grep -c 'Cached process > foo (gamma)' .nextflow.log
grep -c 'Cached process > foo (omega)' .nextflow.log
grep 'alpha' stdout
grep 'delta' stdout
grep 'gamma' stdout
grep 'omega' stdout

Some files were not shown because too many files have changed in this diff Show More