kevin/ma
1
0
Fork 0
Code Issues 1 Packages Activity

add nextflow d30e48d

Browse Source
This commit is contained in:
Kevin
2026-04-29 23:01:54 +02:00
parent d0b12d668d
commit 97cc9058d3
2840 changed files with 730250 additions and 0 deletions
Download Patch File Download Diff File Expand all files Collapse all files

1
nextflow/tests-v1/data/data'3.txt Normal file
View File

@@ -0,0 +1 @@
Hello

0
nextflow/tests-v1/data/file[a-b].txt Normal file
View File

2852
nextflow/tests-v1/data/ggal/ggal_1_48850000_49020000.Ggal71.500bpflank.fa Normal file
View File

File diff suppressed because it is too large Load Diff

113
nextflow/tests-v1/data/ggal/ggal_1_48850000_49020000.bed.gff Normal file
View File

@@ -0,0 +1,113 @@
1 protein_coding exon 9363 9365 . + . gene_id "ENSGALG00000011847"; transcript_id "ENSGALT00000019330"; exon_number "1"; gene_name "TTC26"; gene_biotype "protein_coding"; transcript_name "TTC26-201"; exon_id "ENSGALE00000304601";
1 protein_coding CDS 9363 9365 . + 0 gene_id "ENSGALG00000011847"; transcript_id "ENSGALT00000019330"; exon_number "1"; gene_name "TTC26"; gene_biotype "protein_coding"; transcript_name "TTC26-201"; protein_id "ENSGALP00000019304";
1 protein_coding start_codon 9363 9365 . + 0 gene_id "ENSGALG00000011847"; transcript_id "ENSGALT00000019330"; exon_number "1"; gene_name "TTC26"; gene_biotype "protein_coding"; transcript_name "TTC26-201";
1 protein_coding exon 9492 9629 . + . gene_id "ENSGALG00000011847"; transcript_id "ENSGALT00000019330"; exon_number "2"; gene_name "TTC26"; gene_biotype "protein_coding"; transcript_name "TTC26-201"; exon_id "ENSGALE00000128217";
1 protein_coding CDS 9492 9629 . + 0 gene_id "ENSGALG00000011847"; transcript_id "ENSGALT00000019330"; exon_number "2"; gene_name "TTC26"; gene_biotype "protein_coding"; transcript_name "TTC26-201"; protein_id "ENSGALP00000019304";
1 protein_coding exon 9807 9899 . + . gene_id "ENSGALG00000011847"; transcript_id "ENSGALT00000019330"; exon_number "3"; gene_name "TTC26"; gene_biotype "protein_coding"; transcript_name "TTC26-201"; exon_id "ENSGALE00000128207";
1 protein_coding CDS 9807 9899 . + 0 gene_id "ENSGALG00000011847"; transcript_id "ENSGALT00000019330"; exon_number "3"; gene_name "TTC26"; gene_biotype "protein_coding"; transcript_name "TTC26-201"; protein_id "ENSGALP00000019304";
1 protein_coding exon 17513 17627 . + . gene_id "ENSGALG00000011847"; transcript_id "ENSGALT00000019330"; exon_number "4"; gene_name "TTC26"; gene_biotype "protein_coding"; transcript_name "TTC26-201"; exon_id "ENSGALE00000128214";
1 protein_coding CDS 17513 17627 . + 0 gene_id "ENSGALG00000011847"; transcript_id "ENSGALT00000019330"; exon_number "4"; gene_name "TTC26"; gene_biotype "protein_coding"; transcript_name "TTC26-201"; protein_id "ENSGALP00000019304";
1 protein_coding exon 25466 25515 . + . gene_id "ENSGALG00000011847"; transcript_id "ENSGALT00000019330"; exon_number "5"; gene_name "TTC26"; gene_biotype "protein_coding"; transcript_name "TTC26-201"; exon_id "ENSGALE00000128206";
1 protein_coding CDS 25466 25515 . + 2 gene_id "ENSGALG00000011847"; transcript_id "ENSGALT00000019330"; exon_number "5"; gene_name "TTC26"; gene_biotype "protein_coding"; transcript_name "TTC26-201"; protein_id "ENSGALP00000019304";
1 protein_coding exon 26906 27051 . + . gene_id "ENSGALG00000011847"; transcript_id "ENSGALT00000019330"; exon_number "6"; gene_name "TTC26"; gene_biotype "protein_coding"; transcript_name "TTC26-201"; exon_id "ENSGALE00000128212";
1 protein_coding CDS 26906 27051 . + 0 gene_id "ENSGALG00000011847"; transcript_id "ENSGALT00000019330"; exon_number "6"; gene_name "TTC26"; gene_biotype "protein_coding"; transcript_name "TTC26-201"; protein_id "ENSGALP00000019304";
1 protein_coding exon 28318 28489 . + . gene_id "ENSGALG00000011847"; transcript_id "ENSGALT00000019330"; exon_number "7"; gene_name "TTC26"; gene_biotype "protein_coding"; transcript_name "TTC26-201"; exon_id "ENSGALE00000128210";
1 protein_coding CDS 28318 28489 . + 1 gene_id "ENSGALG00000011847"; transcript_id "ENSGALT00000019330"; exon_number "7"; gene_name "TTC26"; gene_biotype "protein_coding"; transcript_name "TTC26-201"; protein_id "ENSGALP00000019304";
1 protein_coding exon 28902 28976 . + . gene_id "ENSGALG00000011847"; transcript_id "ENSGALT00000019330"; exon_number "8"; gene_name "TTC26"; gene_biotype "protein_coding"; transcript_name "TTC26-201"; exon_id "ENSGALE00000128202";
1 protein_coding CDS 28902 28976 . + 0 gene_id "ENSGALG00000011847"; transcript_id "ENSGALT00000019330"; exon_number "8"; gene_name "TTC26"; gene_biotype "protein_coding"; transcript_name "TTC26-201"; protein_id "ENSGALP00000019304";
1 protein_coding exon 30102 30204 . + . gene_id "ENSGALG00000011847"; transcript_id "ENSGALT00000019330"; exon_number "9"; gene_name "TTC26"; gene_biotype "protein_coding"; transcript_name "TTC26-201"; exon_id "ENSGALE00000128218";
1 protein_coding CDS 30102 30204 . + 0 gene_id "ENSGALG00000011847"; transcript_id "ENSGALT00000019330"; exon_number "9"; gene_name "TTC26"; gene_biotype "protein_coding"; transcript_name "TTC26-201"; protein_id "ENSGALP00000019304";
1 protein_coding exon 32102 32157 . + . gene_id "ENSGALG00000011847"; transcript_id "ENSGALT00000019330"; exon_number "10"; gene_name "TTC26"; gene_biotype "protein_coding"; transcript_name "TTC26-201"; exon_id "ENSGALE00000128203";
1 protein_coding CDS 32102 32157 . + 2 gene_id "ENSGALG00000011847"; transcript_id "ENSGALT00000019330"; exon_number "10"; gene_name "TTC26"; gene_biotype "protein_coding"; transcript_name "TTC26-201"; protein_id "ENSGALP00000019304";
1 protein_coding exon 33998 34051 . + . gene_id "ENSGALG00000011847"; transcript_id "ENSGALT00000019330"; exon_number "11"; gene_name "TTC26"; gene_biotype "protein_coding"; transcript_name "TTC26-201"; exon_id "ENSGALE00000128215";
1 protein_coding CDS 33998 34051 . + 0 gene_id "ENSGALG00000011847"; transcript_id "ENSGALT00000019330"; exon_number "11"; gene_name "TTC26"; gene_biotype "protein_coding"; transcript_name "TTC26-201"; protein_id "ENSGALP00000019304";
1 protein_coding exon 34472 34535 . + . gene_id "ENSGALG00000011847"; transcript_id "ENSGALT00000019330"; exon_number "12"; gene_name "TTC26"; gene_biotype "protein_coding"; transcript_name "TTC26-201"; exon_id "ENSGALE00000128204";
1 protein_coding CDS 34472 34535 . + 0 gene_id "ENSGALG00000011847"; transcript_id "ENSGALT00000019330"; exon_number "12"; gene_name "TTC26"; gene_biotype "protein_coding"; transcript_name "TTC26-201"; protein_id "ENSGALP00000019304";
1 protein_coding exon 39445 39533 . + . gene_id "ENSGALG00000011847"; transcript_id "ENSGALT00000019330"; exon_number "13"; gene_name "TTC26"; gene_biotype "protein_coding"; transcript_name "TTC26-201"; exon_id "ENSGALE00000128213";
1 protein_coding CDS 39445 39533 . + 2 gene_id "ENSGALG00000011847"; transcript_id "ENSGALT00000019330"; exon_number "13"; gene_name "TTC26"; gene_biotype "protein_coding"; transcript_name "TTC26-201"; protein_id "ENSGALP00000019304";
1 protein_coding exon 44828 44911 . + . gene_id "ENSGALG00000011847"; transcript_id "ENSGALT00000019330"; exon_number "14"; gene_name "TTC26"; gene_biotype "protein_coding"; transcript_name "TTC26-201"; exon_id "ENSGALE00000128211";
1 protein_coding CDS 44828 44911 . + 0 gene_id "ENSGALG00000011847"; transcript_id "ENSGALT00000019330"; exon_number "14"; gene_name "TTC26"; gene_biotype "protein_coding"; transcript_name "TTC26-201"; protein_id "ENSGALP00000019304";
1 protein_coding exon 46449 46518 . + . gene_id "ENSGALG00000011847"; transcript_id "ENSGALT00000019330"; exon_number "15"; gene_name "TTC26"; gene_biotype "protein_coding"; transcript_name "TTC26-201"; exon_id "ENSGALE00000128219";
1 protein_coding CDS 46449 46518 . + 0 gene_id "ENSGALG00000011847"; transcript_id "ENSGALT00000019330"; exon_number "15"; gene_name "TTC26"; gene_biotype "protein_coding"; transcript_name "TTC26-201"; protein_id "ENSGALP00000019304";
1 protein_coding exon 48688 48794 . + . gene_id "ENSGALG00000011847"; transcript_id "ENSGALT00000019330"; exon_number "16"; gene_name "TTC26"; gene_biotype "protein_coding"; transcript_name "TTC26-201"; exon_id "ENSGALE00000128205";
1 protein_coding CDS 48688 48794 . + 2 gene_id "ENSGALG00000011847"; transcript_id "ENSGALT00000019330"; exon_number "16"; gene_name "TTC26"; gene_biotype "protein_coding"; transcript_name "TTC26-201"; protein_id "ENSGALP00000019304";
1 protein_coding exon 52850 52983 . + . gene_id "ENSGALG00000011847"; transcript_id "ENSGALT00000019330"; exon_number "17"; gene_name "TTC26"; gene_biotype "protein_coding"; transcript_name "TTC26-201"; exon_id "ENSGALE00000128221";
1 protein_coding CDS 52850 52983 . + 0 gene_id "ENSGALG00000011847"; transcript_id "ENSGALT00000019330"; exon_number "17"; gene_name "TTC26"; gene_biotype "protein_coding"; transcript_name "TTC26-201"; protein_id "ENSGALP00000019304";
1 protein_coding exon 54245 54379 . + . gene_id "ENSGALG00000011847"; transcript_id "ENSGALT00000019330"; exon_number "18"; gene_name "TTC26"; gene_biotype "protein_coding"; transcript_name "TTC26-201"; exon_id "ENSGALE00000307910";
1 protein_coding CDS 54245 54353 . + 1 gene_id "ENSGALG00000011847"; transcript_id "ENSGALT00000019330"; exon_number "18"; gene_name "TTC26"; gene_biotype "protein_coding"; transcript_name "TTC26-201"; protein_id "ENSGALP00000019304";
1 protein_coding stop_codon 54354 54356 . + 0 gene_id "ENSGALG00000011847"; transcript_id "ENSGALT00000019330"; exon_number "18"; gene_name "TTC26"; gene_biotype "protein_coding"; transcript_name "TTC26-201";
1 protein_coding exon 67033 67073 . + . gene_id "ENSGALG00000011854"; transcript_id "ENSGALT00000019339"; exon_number "1"; gene_name "UBN2"; gene_biotype "protein_coding"; transcript_name "UBN2-201"; exon_id "ENSGALE00000287083";
1 protein_coding CDS 67033 67073 . + 0 gene_id "ENSGALG00000011854"; transcript_id "ENSGALT00000019339"; exon_number "1"; gene_name "UBN2"; gene_biotype "protein_coding"; transcript_name "UBN2-201"; protein_id "ENSGALP00000019313";
1 protein_coding start_codon 67033 67035 . + 0 gene_id "ENSGALG00000011854"; transcript_id "ENSGALT00000019339"; exon_number "1"; gene_name "UBN2"; gene_biotype "protein_coding"; transcript_name "UBN2-201";
1 protein_coding exon 67259 67616 . + . gene_id "ENSGALG00000011854"; transcript_id "ENSGALT00000019339"; exon_number "2"; gene_name "UBN2"; gene_biotype "protein_coding"; transcript_name "UBN2-201"; exon_id "ENSGALE00000128246";
1 protein_coding CDS 67259 67616 . + 1 gene_id "ENSGALG00000011854"; transcript_id "ENSGALT00000019339"; exon_number "2"; gene_name "UBN2"; gene_biotype "protein_coding"; transcript_name "UBN2-201"; protein_id "ENSGALP00000019313";
1 protein_coding exon 71917 72009 . + . gene_id "ENSGALG00000011854"; transcript_id "ENSGALT00000019339"; exon_number "3"; gene_name "UBN2"; gene_biotype "protein_coding"; transcript_name "UBN2-201"; exon_id "ENSGALE00000128244";
1 protein_coding CDS 71917 72009 . + 0 gene_id "ENSGALG00000011854"; transcript_id "ENSGALT00000019339"; exon_number "3"; gene_name "UBN2"; gene_biotype "protein_coding"; transcript_name "UBN2-201"; protein_id "ENSGALP00000019313";
1 protein_coding exon 77548 77649 . + . gene_id "ENSGALG00000011854"; transcript_id "ENSGALT00000019339"; exon_number "4"; gene_name "UBN2"; gene_biotype "protein_coding"; transcript_name "UBN2-201"; exon_id "ENSGALE00000128251";
1 protein_coding CDS 77548 77649 . + 0 gene_id "ENSGALG00000011854"; transcript_id "ENSGALT00000019339"; exon_number "4"; gene_name "UBN2"; gene_biotype "protein_coding"; transcript_name "UBN2-201"; protein_id "ENSGALP00000019313";
1 protein_coding exon 89127 89264 . + . gene_id "ENSGALG00000011854"; transcript_id "ENSGALT00000019339"; exon_number "5"; gene_name "UBN2"; gene_biotype "protein_coding"; transcript_name "UBN2-201"; exon_id "ENSGALE00000128258";
1 protein_coding CDS 89127 89264 . + 0 gene_id "ENSGALG00000011854"; transcript_id "ENSGALT00000019339"; exon_number "5"; gene_name "UBN2"; gene_biotype "protein_coding"; transcript_name "UBN2-201"; protein_id "ENSGALP00000019313";
1 protein_coding exon 90317 90429 . + . gene_id "ENSGALG00000011854"; transcript_id "ENSGALT00000019339"; exon_number "6"; gene_name "UBN2"; gene_biotype "protein_coding"; transcript_name "UBN2-201"; exon_id "ENSGALE00000128248";
1 protein_coding CDS 90317 90429 . + 0 gene_id "ENSGALG00000011854"; transcript_id "ENSGALT00000019339"; exon_number "6"; gene_name "UBN2"; gene_biotype "protein_coding"; transcript_name "UBN2-201"; protein_id "ENSGALP00000019313";
1 protein_coding exon 91255 91753 . + . gene_id "ENSGALG00000011854"; transcript_id "ENSGALT00000019339"; exon_number "7"; gene_name "UBN2"; gene_biotype "protein_coding"; transcript_name "UBN2-201"; exon_id "ENSGALE00000128255";
1 protein_coding CDS 91255 91753 . + 1 gene_id "ENSGALG00000011854"; transcript_id "ENSGALT00000019339"; exon_number "7"; gene_name "UBN2"; gene_biotype "protein_coding"; transcript_name "UBN2-201"; protein_id "ENSGALP00000019313";
1 protein_coding exon 95137 95207 . + . gene_id "ENSGALG00000011854"; transcript_id "ENSGALT00000019339"; exon_number "8"; gene_name "UBN2"; gene_biotype "protein_coding"; transcript_name "UBN2-201"; exon_id "ENSGALE00000128250";
1 protein_coding CDS 95137 95207 . + 0 gene_id "ENSGALG00000011854"; transcript_id "ENSGALT00000019339"; exon_number "8"; gene_name "UBN2"; gene_biotype "protein_coding"; transcript_name "UBN2-201"; protein_id "ENSGALP00000019313";
1 protein_coding exon 95937 96066 . + . gene_id "ENSGALG00000011854"; transcript_id "ENSGALT00000019339"; exon_number "9"; gene_name "UBN2"; gene_biotype "protein_coding"; transcript_name "UBN2-201"; exon_id "ENSGALE00000128253";
1 protein_coding CDS 95937 96066 . + 1 gene_id "ENSGALG00000011854"; transcript_id "ENSGALT00000019339"; exon_number "9"; gene_name "UBN2"; gene_biotype "protein_coding"; transcript_name "UBN2-201"; protein_id "ENSGALP00000019313";
1 protein_coding exon 97416 97534 . + . gene_id "ENSGALG00000011854"; transcript_id "ENSGALT00000019339"; exon_number "10"; gene_name "UBN2"; gene_biotype "protein_coding"; transcript_name "UBN2-201"; exon_id "ENSGALE00000128256";
1 protein_coding CDS 97416 97534 . + 0 gene_id "ENSGALG00000011854"; transcript_id "ENSGALT00000019339"; exon_number "10"; gene_name "UBN2"; gene_biotype "protein_coding"; transcript_name "UBN2-201"; protein_id "ENSGALP00000019313";
1 protein_coding exon 98166 98279 . + . gene_id "ENSGALG00000011854"; transcript_id "ENSGALT00000019339"; exon_number "11"; gene_name "UBN2"; gene_biotype "protein_coding"; transcript_name "UBN2-201"; exon_id "ENSGALE00000128260";
1 protein_coding CDS 98166 98279 . + 1 gene_id "ENSGALG00000011854"; transcript_id "ENSGALT00000019339"; exon_number "11"; gene_name "UBN2"; gene_biotype "protein_coding"; transcript_name "UBN2-201"; protein_id "ENSGALP00000019313";
1 protein_coding exon 99699 99842 . + . gene_id "ENSGALG00000011854"; transcript_id "ENSGALT00000019339"; exon_number "12"; gene_name "UBN2"; gene_biotype "protein_coding"; transcript_name "UBN2-201"; exon_id "ENSGALE00000128257";
1 protein_coding CDS 99699 99842 . + 1 gene_id "ENSGALG00000011854"; transcript_id "ENSGALT00000019339"; exon_number "12"; gene_name "UBN2"; gene_biotype "protein_coding"; transcript_name "UBN2-201"; protein_id "ENSGALP00000019313";
1 protein_coding exon 105181 105231 . + . gene_id "ENSGALG00000011854"; transcript_id "ENSGALT00000019339"; exon_number "13"; gene_name "UBN2"; gene_biotype "protein_coding"; transcript_name "UBN2-201"; exon_id "ENSGALE00000128245";
1 protein_coding CDS 105181 105231 . + 1 gene_id "ENSGALG00000011854"; transcript_id "ENSGALT00000019339"; exon_number "13"; gene_name "UBN2"; gene_biotype "protein_coding"; transcript_name "UBN2-201"; protein_id "ENSGALP00000019313";
1 protein_coding exon 106560 106602 . + . gene_id "ENSGALG00000011854"; transcript_id "ENSGALT00000019339"; exon_number "14"; gene_name "UBN2"; gene_biotype "protein_coding"; transcript_name "UBN2-201"; exon_id "ENSGALE00000128247";
1 protein_coding CDS 106560 106602 . + 1 gene_id "ENSGALG00000011854"; transcript_id "ENSGALT00000019339"; exon_number "14"; gene_name "UBN2"; gene_biotype "protein_coding"; transcript_name "UBN2-201"; protein_id "ENSGALP00000019313";
1 protein_coding exon 107138 108673 . + . gene_id "ENSGALG00000011854"; transcript_id "ENSGALT00000019339"; exon_number "15"; gene_name "UBN2"; gene_biotype "protein_coding"; transcript_name "UBN2-201"; exon_id "ENSGALE00000128259";
1 protein_coding CDS 107138 108673 . + 0 gene_id "ENSGALG00000011854"; transcript_id "ENSGALT00000019339"; exon_number "15"; gene_name "UBN2"; gene_biotype "protein_coding"; transcript_name "UBN2-201"; protein_id "ENSGALP00000019313";
1 protein_coding exon 112436 112682 . + . gene_id "ENSGALG00000011854"; transcript_id "ENSGALT00000019339"; exon_number "16"; gene_name "UBN2"; gene_biotype "protein_coding"; transcript_name "UBN2-201"; exon_id "ENSGALE00000128252";
1 protein_coding CDS 112436 112682 . + 0 gene_id "ENSGALG00000011854"; transcript_id "ENSGALT00000019339"; exon_number "16"; gene_name "UBN2"; gene_biotype "protein_coding"; transcript_name "UBN2-201"; protein_id "ENSGALP00000019313";
1 protein_coding exon 113405 113494 . + . gene_id "ENSGALG00000011854"; transcript_id "ENSGALT00000019339"; exon_number "17"; gene_name "UBN2"; gene_biotype "protein_coding"; transcript_name "UBN2-201"; exon_id "ENSGALE00000128249";
1 protein_coding CDS 113405 113494 . + 2 gene_id "ENSGALG00000011854"; transcript_id "ENSGALT00000019339"; exon_number "17"; gene_name "UBN2"; gene_biotype "protein_coding"; transcript_name "UBN2-201"; protein_id "ENSGALP00000019313";
1 protein_coding exon 114631 114680 . + . gene_id "ENSGALG00000011854"; transcript_id "ENSGALT00000019339"; exon_number "18"; gene_name "UBN2"; gene_biotype "protein_coding"; transcript_name "UBN2-201"; exon_id "ENSGALE00000307389";
1 protein_coding CDS 114631 114677 . + 2 gene_id "ENSGALG00000011854"; transcript_id "ENSGALT00000019339"; exon_number "18"; gene_name "UBN2"; gene_biotype "protein_coding"; transcript_name "UBN2-201"; protein_id "ENSGALP00000019313";
1 protein_coding stop_codon 114678 114680 . + 0 gene_id "ENSGALG00000011854"; transcript_id "ENSGALT00000019339"; exon_number "18"; gene_name "UBN2"; gene_biotype "protein_coding"; transcript_name "UBN2-201";
1 protein_coding exon 123889 123999 . + . gene_id "ENSGALG00000011856"; transcript_id "ENSGALT00000019343"; exon_number "1"; gene_name "C7ORF55"; gene_biotype "protein_coding"; transcript_name "C7ORF55-201"; exon_id "ENSGALE00000295599";
1 protein_coding exon 124324 124872 . + . gene_id "ENSGALG00000011856"; transcript_id "ENSGALT00000019343"; exon_number "2"; gene_name "C7ORF55"; gene_biotype "protein_coding"; transcript_name "C7ORF55-201"; exon_id "ENSGALE00000128271";
1 protein_coding CDS 124744 124872 . + 0 gene_id "ENSGALG00000011856"; transcript_id "ENSGALT00000019343"; exon_number "2"; gene_name "C7ORF55"; gene_biotype "protein_coding"; transcript_name "C7ORF55-201"; protein_id "ENSGALP00000019317";
1 protein_coding start_codon 124744 124746 . + 0 gene_id "ENSGALG00000011856"; transcript_id "ENSGALT00000019343"; exon_number "2"; gene_name "C7ORF55"; gene_biotype "protein_coding"; transcript_name "C7ORF55-201";
1 protein_coding exon 124965 125213 . + . gene_id "ENSGALG00000011856"; transcript_id "ENSGALT00000019343"; exon_number "3"; gene_name "C7ORF55"; gene_biotype "protein_coding"; transcript_name "C7ORF55-201"; exon_id "ENSGALE00000128270";
1 protein_coding CDS 124965 125156 . + 0 gene_id "ENSGALG00000011856"; transcript_id "ENSGALT00000019343"; exon_number "3"; gene_name "C7ORF55"; gene_biotype "protein_coding"; transcript_name "C7ORF55-201"; protein_id "ENSGALP00000019317";
1 protein_coding stop_codon 125157 125159 . + 0 gene_id "ENSGALG00000011856"; transcript_id "ENSGALT00000019343"; exon_number "3"; gene_name "C7ORF55"; gene_biotype "protein_coding"; transcript_name "C7ORF55-201";
1 protein_coding exon 128066 128393 . + . gene_id "ENSGALG00000011857"; transcript_id "ENSGALT00000019344"; exon_number "1"; gene_name "LUC7L2"; gene_biotype "protein_coding"; transcript_name "LUC7L2-201"; exon_id "ENSGALE00000288455";
1 protein_coding CDS 128333 128393 . + 0 gene_id "ENSGALG00000011857"; transcript_id "ENSGALT00000019344"; exon_number "1"; gene_name "LUC7L2"; gene_biotype "protein_coding"; transcript_name "LUC7L2-201"; protein_id "ENSGALP00000019318";
1 protein_coding start_codon 128333 128335 . + 0 gene_id "ENSGALG00000011857"; transcript_id "ENSGALT00000019344"; exon_number "1"; gene_name "LUC7L2"; gene_biotype "protein_coding"; transcript_name "LUC7L2-201";
1 protein_coding exon 136408 136502 . + . gene_id "ENSGALG00000011857"; transcript_id "ENSGALT00000019344"; exon_number "2"; gene_name "LUC7L2"; gene_biotype "protein_coding"; transcript_name "LUC7L2-201"; exon_id "ENSGALE00000195481";
1 protein_coding CDS 136408 136502 . + 2 gene_id "ENSGALG00000011857"; transcript_id "ENSGALT00000019344"; exon_number "2"; gene_name "LUC7L2"; gene_biotype "protein_coding"; transcript_name "LUC7L2-201"; protein_id "ENSGALP00000019318";
1 protein_coding exon 145684 145782 . + . gene_id "ENSGALG00000011857"; transcript_id "ENSGALT00000019344"; exon_number "3"; gene_name "LUC7L2"; gene_biotype "protein_coding"; transcript_name "LUC7L2-201"; exon_id "ENSGALE00000128274";
1 protein_coding CDS 145684 145782 . + 0 gene_id "ENSGALG00000011857"; transcript_id "ENSGALT00000019344"; exon_number "3"; gene_name "LUC7L2"; gene_biotype "protein_coding"; transcript_name "LUC7L2-201"; protein_id "ENSGALP00000019318";
1 protein_coding exon 146627 146737 . + . gene_id "ENSGALG00000011857"; transcript_id "ENSGALT00000019344"; exon_number "4"; gene_name "LUC7L2"; gene_biotype "protein_coding"; transcript_name "LUC7L2-201"; exon_id "ENSGALE00000128279";
1 protein_coding CDS 146627 146737 . + 0 gene_id "ENSGALG00000011857"; transcript_id "ENSGALT00000019344"; exon_number "4"; gene_name "LUC7L2"; gene_biotype "protein_coding"; transcript_name "LUC7L2-201"; protein_id "ENSGALP00000019318";
1 protein_coding exon 147215 147358 . + . gene_id "ENSGALG00000011857"; transcript_id "ENSGALT00000019344"; exon_number "5"; gene_name "LUC7L2"; gene_biotype "protein_coding"; transcript_name "LUC7L2-201"; exon_id "ENSGALE00000128280";
1 protein_coding CDS 147215 147358 . + 0 gene_id "ENSGALG00000011857"; transcript_id "ENSGALT00000019344"; exon_number "5"; gene_name "LUC7L2"; gene_biotype "protein_coding"; transcript_name "LUC7L2-201"; protein_id "ENSGALP00000019318";
1 protein_coding exon 148372 148548 . + . gene_id "ENSGALG00000011857"; transcript_id "ENSGALT00000019344"; exon_number "6"; gene_name "LUC7L2"; gene_biotype "protein_coding"; transcript_name "LUC7L2-201"; exon_id "ENSGALE00000128275";
1 protein_coding CDS 148372 148548 . + 0 gene_id "ENSGALG00000011857"; transcript_id "ENSGALT00000019344"; exon_number "6"; gene_name "LUC7L2"; gene_biotype "protein_coding"; transcript_name "LUC7L2-201"; protein_id "ENSGALP00000019318";
1 protein_coding exon 150722 150813 . + . gene_id "ENSGALG00000011857"; transcript_id "ENSGALT00000019344"; exon_number "7"; gene_name "LUC7L2"; gene_biotype "protein_coding"; transcript_name "LUC7L2-201"; exon_id "ENSGALE00000128281";
1 protein_coding CDS 150722 150813 . + 0 gene_id "ENSGALG00000011857"; transcript_id "ENSGALT00000019344"; exon_number "7"; gene_name "LUC7L2"; gene_biotype "protein_coding"; transcript_name "LUC7L2-201"; protein_id "ENSGALP00000019318";
1 protein_coding exon 151683 151712 . + . gene_id "ENSGALG00000011857"; transcript_id "ENSGALT00000019344"; exon_number "8"; gene_name "LUC7L2"; gene_biotype "protein_coding"; transcript_name "LUC7L2-201"; exon_id "ENSGALE00000195480";
1 protein_coding CDS 151683 151712 . + 1 gene_id "ENSGALG00000011857"; transcript_id "ENSGALT00000019344"; exon_number "8"; gene_name "LUC7L2"; gene_biotype "protein_coding"; transcript_name "LUC7L2-201"; protein_id "ENSGALP00000019318";
1 protein_coding exon 152519 152713 . + . gene_id "ENSGALG00000011857"; transcript_id "ENSGALT00000019344"; exon_number "9"; gene_name "LUC7L2"; gene_biotype "protein_coding"; transcript_name "LUC7L2-201"; exon_id "ENSGALE00000128277";
1 protein_coding CDS 152519 152713 . + 1 gene_id "ENSGALG00000011857"; transcript_id "ENSGALT00000019344"; exon_number "9"; gene_name "LUC7L2"; gene_biotype "protein_coding"; transcript_name "LUC7L2-201"; protein_id "ENSGALP00000019318";
1 protein_coding exon 158405 159323 . + . gene_id "ENSGALG00000011857"; transcript_id "ENSGALT00000019344"; exon_number "10"; gene_name "LUC7L2"; gene_biotype "protein_coding"; transcript_name "LUC7L2-201"; exon_id "ENSGALE00000128282";
1 protein_coding CDS 158405 158594 . + 1 gene_id "ENSGALG00000011857"; transcript_id "ENSGALT00000019344"; exon_number "10"; gene_name "LUC7L2"; gene_biotype "protein_coding"; transcript_name "LUC7L2-201"; protein_id "ENSGALP00000019318";
1 protein_coding stop_codon 158595 158597 . + 0 gene_id "ENSGALG00000011857"; transcript_id "ENSGALT00000019344"; exon_number "10"; gene_name "LUC7L2"; gene_biotype "protein_coding"; transcript_name "LUC7L2-201";
1 protein_coding exon 167819 167913 . - . gene_id "ENSGALG00000011859"; transcript_id "ENSGALT00000019347"; exon_number "1"; gene_name "GBE"; gene_biotype "protein_coding"; transcript_name "GBE-201"; exon_id "ENSGALE00000248984";
1 protein_coding CDS 167819 167913 . - 0 gene_id "ENSGALG00000011859"; transcript_id "ENSGALT00000019347"; exon_number "1"; gene_name "GBE"; gene_biotype "protein_coding"; transcript_name "GBE-201"; protein_id "ENSGALP00000019321";
1 protein_coding start_codon 167911 167913 . - 0 gene_id "ENSGALG00000011859"; transcript_id "ENSGALT00000019347"; exon_number "1"; gene_name "GBE"; gene_biotype "protein_coding"; transcript_name "GBE-201";
1 protein_coding exon 165545 165776 . - . gene_id "ENSGALG00000011859"; transcript_id "ENSGALT00000019347"; exon_number "2"; gene_name "GBE"; gene_biotype "protein_coding"; transcript_name "GBE-201"; exon_id "ENSGALE00000128296";
1 protein_coding CDS 165545 165776 . - 1 gene_id "ENSGALG00000011859"; transcript_id "ENSGALT00000019347"; exon_number "2"; gene_name "GBE"; gene_biotype "protein_coding"; transcript_name "GBE-201"; protein_id "ENSGALP00000019321";
1 protein_coding exon 163981 164109 . - . gene_id "ENSGALG00000011859"; transcript_id "ENSGALT00000019347"; exon_number "3"; gene_name "GBE"; gene_biotype "protein_coding"; transcript_name "GBE-201"; exon_id "ENSGALE00000128297";
1 protein_coding CDS 163984 164109 . - 0 gene_id "ENSGALG00000011859"; transcript_id "ENSGALT00000019347"; exon_number "3"; gene_name "GBE"; gene_biotype "protein_coding"; transcript_name "GBE-201"; protein_id "ENSGALP00000019321";
1 protein_coding stop_codon 163981 163983 . - 0 gene_id "ENSGALG00000011859"; transcript_id "ENSGALT00000019347"; exon_number "3"; gene_name "GBE"; gene_biotype "protein_coding"; transcript_name "GBE-201";

11748
nextflow/tests-v1/data/ggal/ggal_alpha_1.fq Normal file
View File

File diff suppressed because it is too large Load Diff

11748
nextflow/tests-v1/data/ggal/ggal_alpha_2.fq Normal file
View File

File diff suppressed because it is too large Load Diff

11748
nextflow/tests-v1/data/ggal/ggal_beta_1.fq Normal file
View File

File diff suppressed because it is too large Load Diff

11748
nextflow/tests-v1/data/ggal/ggal_beta_2.fq Normal file
View File

File diff suppressed because it is too large Load Diff

14
nextflow/tests-v1/data/p1.fa Normal file
View File

@@ -0,0 +1,14 @@
>1aboA
NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPS
NYITPVN
>1ycsB
KGVIYALWDYEPQNDDELPMKEGDCMTIIHREDEDEIEWWWARLNDKEGY
VPRNLLGLYP
>1pht
GYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIG
WLNGYNETTGERGDFPGTYVEYIGRKKISP
>1vie
DRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI
N
>1ihvA
NFRVYYRDSRDPVWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRD

3
nextflow/tests-v1/data/p2.fa Normal file
View File

@@ -0,0 +1,3 @@
>1ycsB
KGVIYALWDYEPQNDDELPMKEGDCMTIIHREDEDEIEWWWARLNDKEGY
VPRNLLGLYP

3
nextflow/tests-v1/data/p3.fa Normal file
View File

@@ -0,0 +1,3 @@
>1pht
GYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIG
WLNGYNETTGERGDFPGTYVEYIGRKKISP

3
nextflow/tests-v1/data/p4.fa Normal file
View File

@@ -0,0 +1,3 @@
>1vie
DRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI
N

2
nextflow/tests-v1/data/p5.fa Normal file
View File

@@ -0,0 +1,2 @@
>1ihvA
NFRVYYRDSRDPVWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRD

31
nextflow/tests-v1/data/prot.fa Normal file
View File

@@ -0,0 +1,31 @@
>sp|P12724|ECP_HUMAN Eosinophil cationic protein
MVPKLFTSQICLLLLLGLMGVEGSLHARPPQFTRAQWFAIQHISLNPPRCTIAMRAINNY
RWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNI
SNCTYADRPGRRFYVVACDNRDPRDSPRYPVVPVHLDTTI
>sp|P49913|CAMP_HUMAN Cathelicidin antimicrobial peptide
MKTQRDGHSLGRWSLVLLLLGLVMPLAIIAQVLSYKEAVLRAIDGINQRSSDANLYRLLD
LDPRPTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGS
FDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
>sp|P11006|MAGA_XENLA Magainins
MFKGLFICSLIAVICANALPQPEASADEDMDEREVRGIGKFLHSAGKFGKAFVGEIMKSK
RDAEAVGPEAFADEDLDEREVRGIGKFLHSAKKFGKAFVGEIMNSKRDAEAVGPEAFADE
DLDEREVRGIGKFLHSAKKFGKAFVGEIMNSKRDAEAVGPEAFADEDLDEREVRGIGKFL
HSAKKFGKAFVGEIMNSKRDAEAVGPEAFADEDFDEREVRGIGKFLHSAKKFGKAFVGEI
MNSKRDAEAVGPEAFADEDLDEREVRGIGKFLHSAKKFGKAFVGEIMNSKRDAEAVDDRR
WVE
>sp|P10599|THIO_HUMAN Thioredoxin
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVD
DCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
>sp|P01344|IGF2_HUMAN Insulin-like growth factor II
MGIPMGKSMLVLLTFLAFASCCIAAYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVS
RRSRGIVEECCFRSCDLALLETYCATPAKSERDVSTPPTVLPDNFPRYPVGKFFQYDTWK
QSTQRLRRGLPALLRARRGHVLAKELEAFREAKRHRPLIALPTQDPAHGGAPPEMASNRK
>sp|P01270|PTHY_HUMAN Parathyroid hormone
MIPAKDMAKVMIVMLAICFLTKSDGKSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQ
DVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ

14
nextflow/tests-v1/data/sample.fa Normal file
View File

@@ -0,0 +1,14 @@
>1aboA
NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPS
NYITPVN
>1ycsB
KGVIYALWDYEPQNDDELPMKEGDCMTIIHREDEDEIEWWWARLNDKEGY
VPRNLLGLYP
>1pht
GYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIG
WLNGYNETTGERGDFPGTYVEYIGRKKISP
>1vie
DRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI
N
>1ihvA
NFRVYYRDSRDPVWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRD

6
nextflow/tests-v1/data/scratch_csv_bom.csv Normal file
View File

@@ -0,0 +1,6 @@
sampleId,read1,read2
EXP21001039,L1_read1.fastq,L1_read2.fastq
EXP21001039,L2_read1.fastq,L2_read2.fastq
EXP21001039,L3_read1.fastq,L3_read2.fastq
EXP21001039,L4_read1.fastq,L4_read2.fastq
EXP21001039,L5_read1.fastq,L5_read2.fastq
1 sampleId read1 read2
2 EXP21001039 L1_read1.fastq L1_read2.fastq
3 EXP21001039 L2_read1.fastq L2_read2.fastq
4 EXP21001039 L3_read1.fastq L3_read2.fastq
5 EXP21001039 L4_read1.fastq L4_read2.fastq
6 EXP21001039 L5_read1.fastq L5_read2.fastq

0
nextflow/tests-v1/data/seqs/a.fastq Normal file
View File

0
nextflow/tests-v1/data/seqs/b.fastq Normal file
View File

0
nextflow/tests-v1/data/seqs/c.fastq Normal file
View File